KEGG   Cucumis sativus (cucumber): 101218300Help
Entry
101218300         CDS       T02486                                 

Definition
(RefSeq) hexokinase-1-like
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00010  Glycolysis / Gluconeogenesis
csv00051  Fructose and mannose metabolism
csv00052  Galactose metabolism
csv00500  Starch and sucrose metabolism
csv00520  Amino sugar and nucleotide sugar metabolism
csv01100  Metabolic pathways
csv01110  Biosynthesis of secondary metabolites
csv01200  Carbon metabolism
Module
csv_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
csv_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:csv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101218300
   00051 Fructose and mannose metabolism
    101218300
   00052 Galactose metabolism
    101218300
   00500 Starch and sucrose metabolism
    101218300
   00520 Amino sugar and nucleotide sugar metabolism
    101218300
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    101218300
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csv04131]
    101218300
Enzymes [BR:csv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     101218300
Membrane trafficking [BR:csv04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    101218300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 101218300
NCBI-ProteinID: XP_011648625
UniProt: A0A0A0LKR1
LinkDB All DBs
Position
2
AA seq 498 aa AA seqDB search
MGKVAVGAAVVCAAAVCAAAALVVRHRMRNSGKWARAMAILREFEDKCGTPIGKLRQVAD
AMTVEMHAGLASEGGSKLKMLISYVDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKENR
VVKQEFEEVSIPPHLMVGSSEALFDFIAQALAKFVAEEGEGFHPAPGRQRELGFTFSFPV
RQTSISSGTLIKWTKGFSIEDTVGEDVVGELTKAMEKLKLDMRVTALVNDTIGTLAGGRY
HDNDVIAAVILGTGTNAAYVERAHAIPKWHGLLPKSGEMVINMEWGNFRSSHLSLTEYDH
ALDAESLNPGEQIFEKLISGMYLGEIVRKVLVKMAEEAAIFGDTVPPKLKIPFILRTPHT
SAMHHDTSPDLKVVASKLKDVLEISNTSLKTRKIIVELCDVVATRGARLSAAGILGILKK
LGRDTVRVGEKQKSVVALDGGLYEHYTKFRTTMENTLKELLGDEVAANVFVEHSNDGSGI
GAALLAASHSQYLEVEEP
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggttgcggtgggagcggcggtggtgtgtgcggctgcggtttgtgctgcagcg
gcgttagtggtgcggcatcgaatgagaaactccgggaagtgggcgcgagcaatggccatt
ttgagagagttcgaggacaaatgtggaaccccaattggaaaactcaggcaggtggccgac
gccatgaccgtcgagatgcacgccggccttgcatccgaaggcggtagcaagctcaagatg
ctgatcagctacgtcgataatctcccgaccggagatgaaaaagggctcttctatgcattg
gatctcggcggtacaaattttcgagtgttgcgtgtgcagttgggggggaaggagaaccgg
gttgtcaagcaagaatttgaggaggtttcaatacctccacacttgatggttgggtcatca
gaagctctatttgattttatagctcaagcacttgcaaagtttgttgctgaagaaggtgaa
ggctttcacccagcaccgggtaggcaaagggaattgggttttaccttctccttccctgtt
aggcaaacatcaatatcatcagggacacttattaaatggacgaaaggcttcagcattgaa
gacacggttggagaagatgtggtcggtgaattaaccaaagccatggaaaaactgaaactc
gacatgcgtgtaacagcgttggtaaacgatacgattggaacattagcaggaggtagatac
catgataacgatgtaattgctgctgtgattttaggcaccggaacaaatgcagcttatgta
gagcgtgcccatgcaattcccaagtggcacggtctacttcctaaatcaggagaaatggta
attaacatggaatggggtaacttccggtcctcgcatctgtcgcttacagaatatgatcat
gcattggatgctgagagtttaaaccctggagaacagatcttcgagaagttgatttctggt
atgtacttgggagaaattgtacgtaaagtattggtcaagatggctgaagaagcggctatc
tttggtgacactgttccacccaaactgaaaattccatttatattgaggactcctcacacg
tctgcgatgcatcacgacacgtcacccgacctcaaagttgttgcaagcaaactgaaggat
gtcttggagatatccaatacctccttgaaaacaagaaaaatcatagtggagctctgtgac
gtagttgcaacacggggcgcccgactctctgctgctggtatcttaggcatcctgaaaaaa
ctgggaagagacaccgtccgggttggggagaagcagaagtctgttgtagcattggatgga
gggttgtatgagcactacacaaaattcagaactaccatggaaaacacactgaaggagcta
cttggagatgaggtagctgcaaacgtcttcgtcgagcattcaaacgatggttctggcatc
ggagctgcactacttgcagcctctcactctcaatatcttgaggtagaggagccctaa

DBGET integrated database retrieval system