KEGG   Cucumis sativus (cucumber): 101220309Help
Entry
101220309         CDS       T02486                                 

Definition
(RefSeq) acetylornithine deacetylase-like
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00220  Arginine biosynthesis
csv01100  Metabolic pathways
csv01110  Biosynthesis of secondary metabolites
csv01210  2-Oxocarboxylic acid metabolism
csv01230  Biosynthesis of amino acids
Module
csv_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:csv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    101220309
Enzymes [BR:csv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     101220309
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-GeneID: 101220309
NCBI-ProteinID: XP_004148484
UniProt: A0A0A0LED7
LinkDB All DBs
Position
3
AA seq 442 aa AA seqDB search
MGSTPSIKGTIGELQKESYIPLLAKLIGEAESVQNNPPDGLIPIEDNVGRHVLDALNPYS
TNNGGPLIIKRVSYDDKDERGHLIITYPGTDSKKVISFVGSHMDVVPANAHDDSWKFDPF
SLSIEGDKLRGRGTTDCLGHVALLTELMKKIAQTKLNLKSSIVVIFIVSEENNSIQDIGV
EQLYADGYFDNLKGGPLYWIDTADSQPCIGTGGSIPWTITTTGKLFHSGLPNNAINALEL
AMDALKPLQLKFYEDFPVHPREVEYGFETPSTMKPTQWSYPEGSVNQIPGECIIAGDIRL
TPFYEVSDVISKIEEYIAYTNAHVEELESRGPVSKYTLPDGTRGILKVEFGNPISGIACD
VHSIGFKILAQATMDVLGEVKPFSITGSLPLVKKLQEHGYDVQTVGYGLTDTYHADNEYC
NFSDMANGYKVFARIISQFEDV
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgggttctactccttccattaaaggcactatcggtgagcttcagaaggaatcctacatt
cctttactggccaagctcattggcgaggcggagtccgttcagaacaacccccccgacggt
ctgattcctatagaggataacgtcggtcgtcacgtccttgatgctctcaatccttacagc
actaacaatggcggacccttgatcatcaagcgggtcagctatgacgacaaggatgaacgt
ggacatttgattatcacctatccaggaactgattcgaaaaaggttatctccttcgttgga
agtcacatggacgtcgtccctgcaaatgcacatgacgatagttggaaatttgatccattc
tcattgagtattgaaggtgataaacttcgaggtcgaggaacaacagattgtttgggacat
gttgctctattaacagaactgatgaagaagattgcacaaactaaactgaatttgaagtca
tctattgttgttatattcattgtctctgaagaaaacaattcaatccaagacattggagtt
gaacagctttatgctgatggatacttcgataatttaaaaggaggacctttatattggatt
gacacagcagattcacaaccttgtattggaactggtggttcaattccttggacaatcacc
acaactggaaaacttttccatagtggtttgccaaacaacgctattaatgctctggagtta
gctatggatgctcttaaaccacttcaattaaagttttatgaagattttcctgttcatccc
agagaggtagaatatggatttgaaactccatcaactatgaaaccaacccaatggagctat
ccagaaggtagcgttaatcaaattcctggagaatgtatcattgcaggggatataaggtta
actcccttctacgaagtgagtgatgttataagcaaaattgaagagtatattgcgtacacc
aatgcacatgtggaggaacttgaatcaaggggtcctgtttcaaagtataccttaccagat
ggcaccaggggaattcttaaggtagaatttggaaacccaatatcaggaattgcatgtgat
gttcattctattggctttaaaattttagcccaagcaaccatggacgttttaggagaggtc
aaacctttctccattacaggaagtttgccacttgttaaaaaacttcaggaacacggctac
gatgttcaaactgttggctatggtttaacagatacataccatgcagataatgaatattgt
aactttagtgatatggccaatggctacaaggtttttgccagaatcatctctcaatttgaa
gatgtgtga

DBGET integrated database retrieval system