KEGG   Cucumis sativus (cucumber): 101220730Help
Entry
101220730         CDS       T02486                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00010  Glycolysis / Gluconeogenesis
csv00020  Citrate cycle (TCA cycle)
csv00620  Pyruvate metabolism
csv01100  Metabolic pathways
csv01110  Biosynthesis of secondary metabolites
csv01200  Carbon metabolism
Module
csv_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:csv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101220730
   00020 Citrate cycle (TCA cycle)
    101220730
   00620 Pyruvate metabolism
    101220730
Enzymes [BR:csv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     101220730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 101220730
NCBI-ProteinID: XP_011655770
UniProt: A0A0A0KR34
LinkDB All DBs
Position
5
AA seq 487 aa AA seqDB search
MASPFLSRAALSSNTTSVPFSFSYSVSSRLPWSSSRSHTSVPANYRRRLPVIQSKIREIF
MPALSSTMTEGKIVSWVKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVVGEGET
APVGAPIGLLAETEEEVAEAKAKAASKSTSAPAAPAAAVSPSPPPPSSSPAPAISQSSPP
SDGPKKIVATPQAKKLAKQHKVDIGSVTGTGPFGRITPADVEAAAGIAPSKPAVSNVASP
VAAEAAAVPSKASAAPSNLPPPVPGSTVVPFTTMQAAVSKNMVESLSVPTFRVGYPVSTD
ALDALYEKVKPKGVTMTALLAKAAAMALAQHPVVNASCKDGKSFTYNSNINIAVAVAING
GLITPVLQDADKLDLYLLSQKWKELVEKARSKQLQPHEYNSGTFTLSNLGMFGVDKFDAI
LPPGQGAIMAVGASKPTVVTDADGFFSVKSKMLVNVTADHRIVYGADLAAFLQTFAKIVE
NPESLTL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggcatcccccttcctttctcgagctgctctctccagcaacaccacctccgttccattt
tcattctcttattcagtctcttctcgcctcccatggagctcttctcgttcacacacctca
gttcccgctaattatcgtcggaggcttcccgtcattcaatccaagattagggagattttc
atgcctgcccttagctccaccatgaccgagggcaagatcgtttcgtgggtcaaatccgaa
ggggacgttctatccaaaggcgagagcgttgtcgttgtggagtctgataaggccgacatg
gatgttgagactttctatgacggaattctcgctgctattgttgttggagagggtgaaact
gctcctgttggagctccgattggtttattggctgagactgaagaggaagttgctgaggct
aaggctaaagctgcgtctaaatccacttcggctcctgcagctcctgcggctgctgtttct
ccctctcctccccctccctcttcgagtcctgctccggcaatatctcagtcatcgcctccg
tcggacgggcccaagaagatcgtggctactcctcaggcgaagaagctagctaaacagcat
aaggtggatattggatcggtaactggtactggtccattcggtcgaattactcccgcggat
gtggaggctgccgctggaattgccccttcgaagcctgctgtaagcaatgtagcttcaccc
gtggctgctgaggctgccgcggttccatcgaaagcttctgcagctccttccaacttgcct
cctccagttccaggctcgactgttgtgccattcacgacaatgcaggcggcggtgtctaag
aatatggtggagagtctctctgttcctacattcagagttggttatccggtgtccactgat
gctttggatgccctctatgagaaggtgaaaccaaagggtgtcacaatgactgccctcttg
gccaaggctgctgcaatggccctcgctcagcatcctgttgtaaatgcaagctgtaaagac
gggaaaagttttacgtataatagcaacattaatattgcagtagccgtggctatcaacggt
gggttgataacacctgttcttcaggatgcagataagttggacctctacctgctgtctcaa
aaatggaaagaattggttgagaaagctagatccaagcagcttcagccccatgaatacaat
tcaggaacttttacactttccaatctggggatgtttggagtggacaagttcgatgctata
cttcctcctggccagggagctatcatggccgttggagcatcaaagcctactgttgtcact
gatgctgatggctttttcagcgtgaaaagtaaaatgttggtgaatgtgactgctgatcac
cgaatagtttatggtgctgacttggctgccttccttcagaccttcgcaaagatagttgag
aatccagaaagcctgaccttgtag

DBGET integrated database retrieval system