KEGG   Cucumis sativus (cucumber): 101221690Help
Entry
101221690         CDS       T02486                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00040  Pentose and glucuronate interconversions
csv00051  Fructose and mannose metabolism
csv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101221690
   00051 Fructose and mannose metabolism
    101221690
Enzymes [BR:csv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     101221690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_2 AlaDh_PNT_C Sacchrp_dh_NADP Methyltransf_25 NCD3G UDPG_MGDP_dh_N PALP 2-Hacid_dh_C MTS Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 101221690
NCBI-ProteinID: XP_011651132
UniProt: A0A0A0L6D4
LinkDB All DBs
Position
3
AA seq 346 aa AA seqDB search
MGKGGMSQGGSGEDGVEENMAAWLLGINNLKIQPFHLPPLGPHDVRIKMKAVGICGSDVH
YLKNLKLAHYVVKEPMVIGHECAGIVAEVGADVKHLVPGDRVALEPGISCWRCGQCKEGR
YNLCPDMKFFATPPIHGSLANEVVHPADLCFKLPENVSLEEGAMCEPLSVGVHACRRANV
GPETNVLIMGAGPIGLVTLMAARAFGAPRVVIVDVDDYRLSVAKDLGADEVVKVSIDLQD
VDQDVTQIQKAMKGEIDVTLDCAGFEKTMSTALQASRSGGKVCLVGMGHNEMTVPLTSAA
AREVDIVGVFRYKNTWPVCLEFIRSGKIDVKPLITHRFGFSQKEVE
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaggaggaatgtctcaggggggcagtggcgaagatggagttgaagaaaatatg
gctgcttggcttctgggtatcaataacttgaagattcaacctttccacctacctcctctt
ggaccccatgatgttagaattaagatgaaggccgttggtatctgcggcagtgatgttcac
tacctcaagaatctgaaattggcacactatgttgttaaagagccaatggtgattgggcat
gagtgcgctgggattgttgctgaagttggggctgatgttaagcatttagtgccgggggat
cgggttgcactggagcctggaattagttgctggagatgtggtcaatgcaaagaaggccgc
tacaatctgtgcccagacatgaagttctttgccactccccctattcatggttctcttgcg
aatgaggtggttcatccagcggacctgtgttttaaattgccagaaaatgttagcttagag
gaaggagccatgtgtgagcccttaagtgttggtgttcatgcttgtcgacgtgctaatgtt
ggtccagaaacaaatgttttgatcatgggagccggaccaattgggcttgtaactttgatg
gctgcacgtgcatttggtgcaccccgggttgtcattgttgatgtggatgactatcgattg
tctgttgcaaaggatcttggagcagatgaagttgttaaagtttcaattgaccttcaggat
gtagatcaagatgtcactcagattcaaaaagccatgaaaggtgagatagatgtgacattg
gactgtgctggctttgaaaagacaatgtcaacagccttacaagccagccgatctggtggc
aaagtttgtcttgttggaatgggtcacaatgagatgactgttccactaacttcagctgca
gcaagggaagttgacatagttggcgtgtttcggtacaaaaacacatggcctgtgtgcttg
gagtttataagaagtggtaagattgatgtgaagccgcttataacacacagatttggtttc
tcacagaaggaggtggaatag

DBGET integrated database retrieval system