KEGG   Cucumis sativus (cucumber): 101221780Help
Entry
101221780         CDS       T02486                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:csv00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101221780
Enzymes [BR:csv01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     101221780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 101221780
NCBI-ProteinID: XP_004145768
UniProt: A0A0A0KEQ1
LinkDB All DBs
Position
6
AA seq 223 aa AA seqDB search
MQAVLAAMAAQSLLSVSLSNYVALPPFSNSSSSSSLSLTSSFHGASLKLPRHSLSLAASV
APKPLAIVAATKKAVAVLKGTSAVEGVVTLTQEDDGPTSVNVRITGLTPGLHGFHLHEFG
DTTNGCISTGAHFNPNKLTHGAPEDEIRHAGDLGNITANADGVAEAIIVDNQIPLSGPYS
VVGRAFVVHELEDDLGKGGHELSLTTGNAGGRLACGVVGLTPV
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcagttcttgcagctatggccgcacaatcacttctatctgtttccctttccaac
tacgtcgcattgcccccattctccaattcttcatcttcatcttctctttctctcacctcc
tctttccatggcgcctctctcaaactccctcgccactccctctccctcgctgcctccgtt
gccccaaaaccccttgctatcgtcgctgccaccaaaaaagctgtcgctgtcctcaaggga
acttccgccgttgaaggcgttgtcacgctcacccaagaggacgatggtccaacatctgtc
aatgtgcgtattaccgggctcaccccaggtcttcatggattccatcttcatgaatttgga
gacacaacaaatggatgcatttctacaggagcacatttcaatcctaacaagttaacgcat
ggtgctcccgaggacgaaatccgacatgcgggtgacctgggaaacataactgccaatgct
gatggagtagcagaggcaatcattgtagataaccagattcctcttagcggcccctattct
gtagttggaagagcctttgtggtacatgagcttgaggatgatctaggaaaaggaggtcat
gaactcagtttaaccactggcaatgcgggtggaagattggcatgtggtgttgtcggtctt
actcctgtgtga

DBGET integrated database retrieval system