KEGG   Cucumis sativus (cucumber): 101222210Help
Entry
101222210         CDS       T02486                                 

Definition
(RefSeq) histone-lysine N-methyltransferase family member SUVH9
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:csv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101222210
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csv03036]
    101222210
Enzymes [BR:csv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101222210
Chromosome and associated proteins [BR:csv03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101222210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAD_SRA Pre-SET SET
Motif
Other DBs
NCBI-GeneID: 101222210
NCBI-ProteinID: XP_004134031
UniProt: A0A0A0L851
LinkDB All DBs
Position
3
AA seq 695 aa AA seqDB search
MDSPIPFQDLNLLPDPSSTAVMTAATSPKTATGINSSFNKFVDTGKLLTPKLEPKLEPFD
DLFETRESQQPQSVQQPFLSTPSSNFFSNTDFSQTPFSDQNHTPLSQSSSISSDKDNVYS
EFYRISQLFRSAFGKGLQSYGDADVEVVDPDAQAIVPVPEENQISTVVVSKRRYDKRSSE
LVRVTDLGVEDQRYFRDVVRRTRMIFDSLRVLSTAEEEKSPGLMRRLRGDLRASSLMRER
GLWLNRDKRIVGSIPGVHIGDLFFFRMELCVVGLHGQAQAGIDYVPASQSSNGEPIATSI
IVSGGYEDDEDAGDMIIYTGHGGQDKFSKQCMHQKLEGGNLALERSMHYGIEVRVIRGMK
YAGSVASKIYVYDGLYRILDCWFDVGKSGFGVYKYKLLRIDGQAEMGSSILKFAENLRTK
PLSLRPSGYLSLDISMKKEAVPVLLFNDIDNDQEPLYYEYLVRTVFPPFAFHQSGSGTGC
SCVTSCVHDCFCAMKNGGEFGYDQNGFLVRGKPIIFECGPFCQCPPQCRNRVSQKGLKHR
LEVFRSRETGWGVRSLDLIHAGAFICEYAGVVLTREQAQVFSMNGDTLIYPNRFSDRWAE
WGDLSQIYSNYVRPSYPSVPPLDFAMDVSRMRNVACYISHSTSPNVLVQFVLYDHNNLMF
PHLMLFAMENIPPLRELSIDYGVADDWSGKLAICN
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atggattctcctatccccttccaagaccttaatcttctccctgacccatcatccactgct
gtaatgaccgccgcaacttcccctaaaacagccactggaatcaactcttctttcaacaaa
tttgttgacaccggcaagttgttgacccctaaacttgaacctaagctcgagcccttcgac
gatcttttcgagactcgggagtctcaacaaccccaatcagttcagcaacccttcttgtcc
accccttcttctaacttcttctctaacactgacttctctcaaacccctttttcagaccaa
aatcatacaccgctttctcagtcttcatccatttcctctgacaaagacaatgtttactcc
gaattttaccgcatttctcagctgttcaggtctgcttttggtaaaggacttcagagctac
ggcgatgccgatgttgaagttgtggatcctgatgctcaagcaattgtccctgttccggag
gagaatcagatttctactgtggtcgtctctaagaggaggtatgataaaaggtcttcggaa
ctcgtcagagtcactgatcttggggttgaggaccagaggtacttccgagatgtggtgaga
cggaccaggatgattttcgattcgctgcgtgtcttatctacggcggaggaggagaagagt
cctggactaatgcggcgacttcggggtgatttgagggcttcctccttgatgagagagcgt
ggactgtggttgaatcgagacaaacggattgttggttcgataccaggggtgcacattggc
gatctattcttctttaggatggaattgtgtgttgtgggattgcatggtcaggctcaagct
ggaatcgactatgttcctgcgagtcagagctccaatggcgagccaattgccactagtata
attgtttctggtggatacgaggacgatgaggatgccggggacatgataatctacacgggt
catggtgggcaagacaaattttcaaaacaatgtatgcaccagaaacttgaaggtgggaat
cttgcactggagagaagtatgcactacgggattgaagtgagggttattcgaggtatgaag
tacgcaggcagtgtagcaagtaagatttatgtatacgatggtctgtatagaattcttgac
tgttggtttgatgtggggaaatcgggttttggtgtctacaagtataagcttttaagaatt
gatggtcaagccgaaatgggtagctccattttgaagtttgcggagaaccttaggaccaaa
ccattgtctttgaggccttctggttatctcagtctcgacatttcaatgaagaaggaggca
gttccagttcttctgtttaatgatattgacaatgatcaagaaccattgtattatgagtat
cttgttaggactgtgttcccacctttcgcctttcaccaatcaggaagtggtactgggtgt
agttgtgttacaagttgcgttcatgattgtttttgtgctatgaaaaatggtggggagttt
ggttatgatcaaaatggatttctagttagagggaagcctataattttcgaatgtggacca
ttctgtcagtgcccccctcaatgtcgaaatcgtgtttcacagaagggcttgaagcacaga
cttgaagtgtttaggtccagggaaacaggttggggtgttagatctttggacttgatacac
gctggtgctttcatatgtgaatatgcaggagttgtcctcacgagggaacaagctcaagtt
ttttccatgaatggtgatacattaatatatccaaatcgtttttcagatagatgggcagaa
tggggcgatctatctcaaatatattctaattatgtgcggccatcttacccttctgttcct
cctctcgattttgcaatggatgtatccagaatgaggaatgttgcttgttatataagccat
agtacatctccaaacgtgttggtgcagttcgtgttatatgatcataataatttaatgttt
cctcaccttatgttgtttgcaatggaaaatatccctcctctgagggagcttagcattgac
tatggtgtggctgatgattggtcagggaaacttgctatctgtaactaa

DBGET integrated database retrieval system