KEGG   Cucumis sativus (cucumber): 105436320Help
Entry
105436320         CDS       T02486                                 

Definition
(RefSeq) alpha-glucosidase-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00052  Galactose metabolism
csv00500  Starch and sucrose metabolism
csv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105436320
   00500 Starch and sucrose metabolism
    105436320
Enzymes [BR:csv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     105436320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 105436320
NCBI-ProteinID: XP_011659883
LinkDB All DBs
Position
Un
AA seq 495 aa AA seqDB search
MVCSFESKDRLRVRITDSTRERWEVPHHILPRPSSSLIRSLPENHVASPKASFISHPASD
LIFTLHDTAPFGFSVLRRSSGDVLFDTSPAFSDSETFLVFKDQYIQLSSSLPKDRSSIFG
IGEQTRKSFKLVPDKNKTLTLWNADIGSVNLDVNLYGAHPFYIDLRSPSQDGKVAAGTTH
GVLLLNSNGMDIMYSGDRITYKVIGGIIDLYFFAGPSPISVVDQYTELIGRPAPVPYWSF
GFHQCRYGYKNVSDIESVVARYAKASIPLEAMWTDIDYMDGYKDFTFDPINFPSQKMKIF
VDNLHKNGQKYVLILDPGISTNNTYGPYIRGTKADIFMKYNGVPYLGDVWPGPVYFPDFF
HPDSETFWGREIQIFRDIVPFDGLWIDMNEISNFITSSTSPLSNLDNPPYMINNARVQRP
LNNKTVPASILHFGNLTEYNTHNLYGFLESRATHASLVKVTGQRPFVLSRSTFVGSGKYT
AHWTGDNGATWNDLG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggtatgcagttttgaaagcaaagaccggttgagagtacgaataacggactcaactcgt
gaacggtgggaggttccacaccatattcttccccgtccatcgagctcccttatccgttca
ctgccggaaaaccatgtcgcctccccgaaagcttctttcatctcccatccagcttccgat
ctcattttcaccctccatgacactgcacccttcggattttccgtgctccgacgatcatcc
ggtgatgtcctctttgacacatcccctgctttctccgattccgagacttttcttgtcttc
aaggatcaatacattcaactatcctcttcgcttcccaaggacagatcctctatctttggc
attggcgagcaaacccggaagtcgttcaagctcgtcccggataaaaacaaaactctaact
ctttggaacgccgatattggtagtgtgaatctcgatgtgaacctctatggtgcacatcct
ttctacattgatctccggtcgccgtctcaagatggtaaagttgcggcagggacgacgcat
ggagttttgttgctcaatagtaatggcatggatattatgtactctggcgataggattaca
tacaaggttattggtggaatcattgatttatacttctttgcgggtccgtcaccaatttcg
gttgtagatcagtatactgagcttattgggcggcctgcacctgtgccttattggtcgttt
ggttttcatcaatgtcgttacggctacaagaatgtttctgacattgaaagtgtagttgct
cgttatgccaaagccagtatacctcttgaagctatgtggacagacattgattacatggat
gggtataaagactttacttttgatcccatcaattttccatcgcagaagatgaagatattt
gttgataatcttcacaaaaatggacaaaaatatgtactcatcttggatcctggtattagt
acaaataatacatatggaccatacattcgaggaacaaaagctgatatctttatgaaatac
aacggggttccatacttgggtgatgtttggcctggacctgtttactttcctgattttttt
catccagacagtgagactttttggggtcgtgagatccaaatttttcgagatattgttcca
tttgacggtctttggatcgatatgaatgagatatcaaattttataacttcttcaaccagc
ccactttctaaccttgataaccctccttacatgattaacaatgctagagttcaacgtccc
cttaataataagactgtgccagcgtcaattcttcattttggtaacttgacagagtataat
actcataacctatacgggttcttagagtcaagggctactcatgcctcattagtaaaagta
acaggccagagaccatttgtgctgtcaagatcaacttttgtaggctctgggaagtacaca
gcacattggaccggagataatggtgcgacgtggaatgatttggga

DBGET integrated database retrieval system