KEGG   Corynebacterium singulare: CSING_02210Help
Entry
CSING_02210       CDS       T03630                                 

Gene name
tuf
Definition
(GenBank) translation elongation factor 1A (EF-1A/EF-Tu)
  KO
K02358  elongation factor Tu
Organism
csx  Corynebacterium singulare
Brite
KEGG Orthology (KO) [BR:csx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:csx03012]
    CSING_02210 (tuf)
   03029 Mitochondrial biogenesis [BR:csx03029]
    CSING_02210 (tuf)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csx04147]
    CSING_02210 (tuf)
Translation factors [BR:csx03012]
 Eukaryotic Type
  Elongation factors
   CSING_02210 (tuf)
 Prokaryotic Type
   CSING_02210 (tuf)
Mitochondrial biogenesis [BR:csx03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CSING_02210 (tuf)
Exosome [BR:csx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CSING_02210 (tuf)
  Exosomal proteins of breast cancer cells
   CSING_02210 (tuf)
  Exosomal proteins of colorectal cancer cells
   CSING_02210 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AJI77996
UniProt: A0A0B6F1T7
LinkDB All DBs
Position
460758..461948
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLADAYPEENTAFAFDMIDKAPEEKE
RGITINISHVEYSTPKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVDDEEIIELVEMEIRELLAEQDYDEDAPIVHISALKAL
EGDEKWVQSVVDLMQACDDSIPDPERELDKPFLMPIEDIFTITGRGTVVTGRVERGSLNV
NEDIEIIGIKDKSMSTTVTGIEMFRKMMDYTEAGDNCGLLLRGTKREEVERGQVCIKPGA
YTPHTKFEGSVYVLKKEEGGRHTPFMDNYRPQFYFRTTDVTGVIKLPEGTEMVMPGDNVE
MTVELIQPVAMDEGLRFAIREGSRTVGAGRVTKIIA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaggagaagttcgagcgtacgaagccgcatgtgaacatcggcaccatcggacac
gtcgaccacggcaagaccaccaccaccgcagcgatcaccaaggttctggctgacgcttac
ccggaggagaacaccgctttcgccttcgacatgatcgataaggctcctgaggagaaggag
cgcggtattaccatcaacatctcccacgttgagtactccaccccgaagcgccactacgca
cacgtggacgccccgggccacgccgactacatcaagaacatgattaccggtgctgctcag
atggacggcgccatcctggttgttgctgcaaccgatggcccgatgccgcagactcgtgag
cacgttctgctcgctcgccaggttggcgttccgtacatcctcgttgcactgaacaagtgc
gacatggttgacgatgaggaaatcatcgagctcgtcgagatggagatccgcgagctgctc
gctgagcaggactacgatgaggacgctccgatcgttcacatctccgctctgaaggctctt
gagggcgacgagaagtgggtacagtccgtcgtcgacctgatgcaggcttgcgatgactcc
attccggatccggagcgcgagctggacaagccgttcctgatgccgatcgaggacatcttc
accattaccggccgcggtaccgttgttaccggccgtgttgagcgtggctccctgaacgtc
aacgaggacatcgaaatcatcggtatcaaggacaagtccatgtccaccaccgttaccggt
atcgagatgttccgcaagatgatggactacaccgaggctggcgacaactgtggtctgctt
ctgcgtggtaccaagcgtgaagaggttgagcgtggccaggtctgcatcaagccgggcgct
tacaccccgcacaccaagttcgagggttccgtctacgtcctgaagaaggaagagggcggc
cgccacaccccgttcatggacaactaccgtccgcagttctacttccgtaccaccgacgtt
accggcgtcatcaagctgccggagggcaccgagatggtcatgccgggcgacaacgttgag
atgaccgttgagctgatccagccggtcgctatggacgagggcctgcgcttcgctatccgc
gagggctcccgtaccgtcggcgctggccgtgttaccaagatcatcgcctaa

DBGET integrated database retrieval system