KEGG   Cenarchaeum symbiosum: CENSYa_1021Help
Entry
CENSYa_1021       CDS       T01380                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
csy  Cenarchaeum symbiosum
Pathway
csy03030  DNA replication
csy03410  Base excision repair
csy03420  Nucleotide excision repair
csy03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:csy00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CENSYa_1021
   03410 Base excision repair
    CENSYa_1021
   03420 Nucleotide excision repair
    CENSYa_1021
   03430 Mismatch repair
    CENSYa_1021
Enzymes [BR:csy01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CENSYa_1021
    6.5.1.6  DNA ligase (ATP or NAD+)
     CENSYa_1021
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     CENSYa_1021
DNA replication proteins [BR:csy03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    CENSYa_1021
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     CENSYa_1021
DNA repair and recombination proteins [BR:csy03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     CENSYa_1021
   NER (nucleotide excision repair)
    Other NER factors
     CENSYa_1021
   MMR (mismatch excision repair)
    Other MMR factors
     CENSYa_1021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: ABK77653
UniProt: A0RWD6
LinkDB All DBs
Position
complement(1077557..1079290)
Genome map
AA seq 577 aa AA seqDB search
MESTAKRLELTGILEELLRETPHEVIAQIVYLIQGKLRPEFEGIELGVAEKLAVRAVSKS
SGMPAARIEAAYRRDGDLGRAASSILEQKTQTTFLAEEITVERVYDTLMRIARLEGARSQ
DMKMRHISSLLNDASPRDACYILKLILGTLRLGIAENTVMDALAAAFTGSKSNRPELERA
YNVSSDLGRVAEAVSSGGLEAVRGFAVAVFSPIRPMLADRVRSESEALEKMGAGLAAEYK
LDGERVQVHLSGGRVELFSRSLENITAYYPDIVERIPGRLRAREAVLEAEAVAVNEETGE
FLPFQELMHRRRKYDIDKAVMRYPITVNFFDILYLDGRDCLGISYSERRALLEGVVDEDS
FARCVPVSTIPDESALEDSLENSINAGCEGLMLKLPDAPYRAGSRGGYWLKLKREYRNEL
GDSLDLVIIGAFFGKGRRTGRYGTLLLATYDDSRDTFPSICKVGTGFTDEDLDQLYQLLS
PRVTLKRNPRIDSGMEADVWFDPEVVMEVVASEITLSPVHKTALDSVRKGAGLALRFPKF
TGKLRTEKTAEDASTDQEVIALYKSQKKVVPDGQPGV
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggagtccacggccaagcggctcgagcttaccggaatactcgaggagctcctccgggag
accccgcatgaagtaatagcccagatagtctacctgatacagggcaagctccgcccggag
tttgaagggatagagcttggcgtggctgagaagcttgcagtccgcgcagtctccaagtcg
tcggggatgccggcggcccgcatagaggccgcctaccgcagggacggggatcttggccgc
gccgcctcgtccattctggaacagaaaacgcagactacgtttcttgctgaagagatcaca
gtcgagcgcgtatatgataccctcatgaggatagcgcgcctcgagggcgcgcgctcgcag
gacatgaagatgaggcacatatcgagccttctcaacgatgcaagcccgcgcgacgcgtgc
tatatcctcaagctgattctcggcacgctccgccttggaatagcagagaacacggtaatg
gatgccttggctgccgcatttaccggttcaaagtccaacaggccggagcttgaaagggcg
tacaacgtatcgagcgaccttgggcgcgtggcagaggccgtctcttctggaggcctcgag
gctgtgcgcggctttgccgtggcggtattcagccccatacggcccatgctagccgacagg
gtccggagcgaatcagaggctctcgaaaagatgggcgccgggcttgctgccgagtacaag
cttgatggcgagcgcgtgcaggtgcacctttctggcggccgcgtggagctcttctccagg
agcctcgagaatatcaccgcatactatccggatattgtagagaggattccaggccgcctg
agggcaagggaggccgtgctggaggcagaagccgtggccgtcaacgaggagacgggcgag
tttctgccgttccaggagctcatgcacaggaggcgcaagtacgatatcgacaaggcggtc
atgcggtatcccataacggtcaactttttcgacatactgtaccttgacgggagggactgc
ctcggcatttcctattccgagaggcgtgctctattggagggggtggtcgacgaggattcc
tttgcaaggtgcgtgccggtatccaccatccccgacgagtccgcgctcgaggattccctc
gagaacagcatcaacgccggctgcgaggggctcatgctcaagctgccggatgccccgtac
agggcgggctcgcgcgggggatactggctcaagctgaaaagggagtaccgaaacgagctt
ggcgacagcctggaccttgtgataataggggcgtttttcggaaaggggaggaggaccggc
aggtacgggaccctgctgcttgccacctatgatgattcgcgcgatacattccctagcatc
tgcaaggtggggacgggctttaccgacgaggatctcgaccagctgtaccagctgctctcg
ccgcgggtgacactcaagagaaacccgcgcatagacagcggcatggaggcagatgtatgg
tttgacccggaggttgtaatggaggtggtcgcctctgagataacgctcagcccggttcac
aagaccgcgctggattctgttagaaagggcgcggggcttgccctgcggtttccaaagttt
acgggcaagctgaggacggagaaaacggcagaagacgcgtcgaccgaccaggaggtgata
gccctgtacaagagccagaagaaggtggtccccgacgggcagcccggcgtgtaa

DBGET integrated database retrieval system