KEGG   Cronobacter sakazakii Sp291: CSSP291_09485Help
Entry
CSSP291_09485     CDS       T02461                                 

Definition
(GenBank) glutathionine S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
csz  Cronobacter sakazakii Sp291
Pathway
csz00480  Glutathione metabolism
csz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CSSP291_09485
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:csz02000]
    CSSP291_09485
Enzymes [BR:csz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CSSP291_09485
Transporters [BR:csz02000]
 Other transporters
  Pores ion channels [TC:1]
   CSSP291_09485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_N GST_C_2 GST_N_3 GST_N_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AGE86486
LinkDB All DBs
Position
1969812..1970420
Genome map
AA seq 202 aa AA seqDB search
MKLFYKAGACSLSPHIILREANIDFTLVAVDLAAKRTETGEDYLTINPKGQVPALLLDDN
TLLTEGVAIVQYIADLVPDRQLLAPVGSMTRYHTLEWLNYIATELHKGFTPLFRPDTPDE
YKTIARAQLQKKFAYVNEALAQKQWLMGLRFSVADAYLFTVLNWAKAVGLEMQAFDNIAD
YHARVKARPAVAAALKAEGLSA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttttacaaagccggcgcgtgttcgctttcgccgcacatcattctgcgcgaa
gccaatatcgattttacgctggtggcggtggatctggccgcaaaacgcacggaaaccggc
gaagactatctgactatcaacccgaaaggtcaggtaccggcgctgctgctggatgacaat
acgctgctgacagaaggcgtggctattgtgcagtacatcgcagatcttgtcccggaccgt
cagttgctcgcgccggttggcagtatgacccgttaccatacgctggagtggctgaactat
atcgccaccgagctgcacaaaggctttacgcccctgttccgcccggatacgccggatgag
tacaagaccatcgcacgcgcgcagctgcagaagaaattcgcgtacgtgaatgaggcgctg
gcgcagaaacagtggctgatggggctgcgcttcagcgtggcggatgcgtatctgtttacc
gtgctgaactgggcgaaagcggtcggacttgagatgcaggcgtttgataatatcgctgac
taccatgcccgcgtgaaagcgcgccctgctgtggcagccgcgctcaaagcggaaggcctg
agcgcgtaa

DBGET integrated database retrieval system