KEGG   Cronobacter sakazakii Sp291: CSSP291_10450Help
Entry
CSSP291_10450     CDS       T02461                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
csz  Cronobacter sakazakii Sp291
Pathway
csz00020  Citrate cycle (TCA cycle)
csz00480  Glutathione metabolism
csz01100  Metabolic pathways
csz01110  Biosynthesis of secondary metabolites
csz01120  Microbial metabolism in diverse environments
csz01130  Biosynthesis of antibiotics
csz01200  Carbon metabolism
csz01210  2-Oxocarboxylic acid metabolism
csz01230  Biosynthesis of amino acids
Module
csz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
csz_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:csz00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CSSP291_10450
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CSSP291_10450
Enzymes [BR:csz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CSSP291_10450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: AGE86675
LinkDB All DBs
Position
complement(2168877..2170127)
Genome map
AA seq 416 aa AA seqDB search
MESKVVVPAEGAKITAQNGKLNVPHNPIIPFIEGDGIGVDVTPAMLKVVDAAVEKAYKGE
RKISWMEIYTGEKSTQLYGQDVWLPQETLDLIREYRVAIKGPLTTPVGGGIRSLNVALRQ
ELDLYVCLRPVRYYQGTPSPVKHPELTDMVIFRENSEDIYAGIEWKADSADAEKVIKFLR
EEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAITNDRESVTLVHKGNIMKFTEGA
FKDWGYQLAREEFGGELIDGGPWVKIKNPNNGKEIVVKDVIADAFLQQILLRPAEYDVIA
CMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILSA
EMMLRHMGWFEAADLIVKGMEGAINNKTVTYDFERLMEGAKLLKCSEFGDAIIANM
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagtagttccggcggaaggtgcaaagatcacagcgcaaaacggcaag
ctgaatgtcccccacaacccgatcatcccgttcattgaaggcgacggtatcggtgtggac
gtgacgccggcgatgctgaaagtggtcgacgccgcggttgagaaagcctacaaaggcgag
cgtaaaatttcctggatggaaatttacaccggtgagaaatctacccagctttacggccag
gatgtctggctgccccaggaaaccctggatctgattcgtgaatatcgcgttgccatcaaa
ggcccgctgactaccccggttggcggcggtattcgttcccttaacgttgccctgcgccag
gagctggacctttacgtctgcctgcgtccggtacgttactaccagggcaccccaagcccg
gttaaacacccggaactgaccgacatggtcattttccgtgaaaactctgaagacatctac
gcgggtatcgagtggaaagccgactccgctgacgctgagaaagtgatcaaattcctgcgt
gaagagatgggcgtgaagaaaatccgcttcccggaacattgcggcatcggcattaagccg
tgttctgaagaaggcaccaaacgcctggtgcgcgcggccattgaatacgccatcactaac
gatcgcgaatccgtgaccctggtgcataaaggcaacatcatgaaattcaccgaaggcgcg
tttaaagactggggctaccagctggcgcgtgaagagttcggcggcgagcttatcgacggc
ggtccgtgggtgaaaatcaagaacccgaacaacggcaaagagatcgttgtgaaagacgtt
atcgccgacgccttcctgcagcagatcctgctgcgtccggcggaatatgacgtcatcgcc
tgtatgaacctgaacggcgactacatctctgacgccctggcggcgcaggttggcggcatc
ggcatcgcgccgggcgcgaacatcggtgacgagtgcgcgctgtttgaagcgacccacggc
accgcgccgaaatacgcaggccaggacaaagtgaacccgggctctatcattctctcagct
gagatgatgctgcgtcatatgggatggttcgaagcggctgacctgattgtcaaaggtatg
gaaggcgctatcaacaacaagaccgtgacctatgacttcgaacgcctgatggaaggcgct
aaactgctgaaatgctcagagtttggcgacgcgattatcgcgaacatgtaa

DBGET integrated database retrieval system