KEGG   Cronobacter sakazakii Sp291: CSSP291_10490
Entry
CSSP291_10490     CDS       T02461                                 

Definition
(GenBank) sensor protein PhoQ
  KO
K07637  two-component system, OmpR family, sensor histidine kinase PhoQ [EC:2.7.13.3]
Organism
csz  Cronobacter sakazakii Sp291
Pathway
csz01503  Cationic antimicrobial peptide (CAMP) resistance
csz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:csz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CSSP291_10490
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    CSSP291_10490
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csz01001]
    CSSP291_10490
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:csz02022]
    CSSP291_10490
   01504 Antimicrobial resistance genes [BR:csz01504]
    CSSP291_10490
Enzymes [BR:csz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     CSSP291_10490
Protein kinases [BR:csz01001]
 Histidine kinases
  OmpR family
   CSSP291_10490
Two-component system [BR:csz02022]
 OmpR family
  PhoQ-PhoP (magnesium transport)
   CSSP291_10490
Antimicrobial resistance genes [BR:csz01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, protease PgtE [MD:M00744]
    CSSP291_10490
SSDB
Motif
Pfam: PhoQ_Sensor HATPase_c HATPase_c_5 HAMP HisKA HATPase_c_2 OmpH DUF3450 Exonuc_VII_L
Other DBs
NCBI-ProteinID: AGE86683
LinkDB
Position
2177774..2179279
AA seq 501 aa
MKKNVLRHFLPLSLRVRFLLATAAVVLVLSLAYGVVALVGYSVSFDKTTFRLLRGESNLF
YTLARFDNGKLTVEIPDHIDRQSPTLTFIYNEKGKLLWSQRDVPRLMKAIRPEWLNANGF
HELETRFSDSRLLLGANRALQKRLNDYDPDKNDETTHSVAVNVYPATTNMPALTVVVVDT
IPDELKSSWSVWNWFIYVLAANLLLVIPLLWLAAWWSLRPIEALAREVRELEEHHREQLN
PYTTRELTSLVHNLNRLLKSERERYEKYRTTLTDLTHSLKTPLSVLQSTLRSLRTGKTDV
EQAEPVMLEQISRISQQIGYYLHRASMRSGNMLLSRELHPVASLLDNLTSALNKVYQRKG
VSITLDISPEIVFIGEKNDFLEVMGNVLDNACKYCLEFVEVTARVADDTLHLVVEDDGPG
IPESKRALVFDRGQRADTLRPGQGVGLSVAREVVEQYNGQILTSTSALGGARMEVIFARQ
QPPVGESSATLRKNLSDNHAE
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgaaaaaaaacgtcctgcgccactttctcccgctctcgctgcgggtgcgctttttactc
gcgaccgcggcggtggtgctggtgctgtcgctcgcctacggcgtggtggcgctggtgggt
tacagcgtcagtttcgataaaaccacctttagactgctgcgcggtgagagcaatctcttc
tatacccttgcccgttttgataacggcaaactgaccgttgagatccctgaccatatcgac
aggcagagcccaacactgacctttatctataacgaaaaaggcaaacttctctggtcgcag
cgcgatgtgccgcgcctgatgaaggcgattcgccccgagtggctcaacgcgaacggtttt
cacgaactggagacgcgctttagcgattcgcgcctgctgctgggcgcaaaccgggcgctg
caaaagcggcttaatgattacgacccggataaaaacgacgaaaccacgcactcggtcgcg
gtcaatgtctatccggcaaccaccaatatgcccgcgctgacggtcgtggtggtggatacg
attcctgacgagctgaaaagctcgtggagcgtctggaactggtttatctatgtgctggcg
gcgaatctgctgctggtgatcccgctcctgtggctcgctgcctggtggagcctgcgcccc
atagaagcgctggcgcgcgaagtgcgcgagctggaagagcaccatcgtgaacaactgaac
ccctacaccacccgcgaactgacaagccttgtccataatctcaaccggctgctgaaaagc
gagcgcgagcgctacgagaaataccgcacaacgctcaccgatctcacccacagcctgaaa
acgccgctgtcggtgctccagagcacgctgcgatcgttgcgtaccggcaaaacggatgtg
gaacaggccgagccggttatgcttgagcagatcagccgtatttcacagcagataggctac
tatctgcatcgcgccagtatgcgcagcggcaatatgctgctgagccgcgagctgcacccg
gtagcgtcattactcgataacctcacttccgcgctgaataaggtctaccagcgtaaaggc
gtcagcattacgctcgatatctcgccggaaattgtctttatcggagagaaaaacgatttt
ctcgaagtgatgggcaacgtgctggataacgcctgtaaatattgcctggagtttgtcgaa
gtgaccgcgcgggtggcggatgacacgctgcacctggtggtggaagatgatggccccggt
attcctgaaagcaaacgcgcgctggtgtttgatcgcggtcagcgggccgatacgctgcgc
ccgggccagggcgttggactgtcggtcgctcgtgaagtggtggagcaatataacgggcag
atcctcaccagcaccagcgcgcttggtggcgcacgcatggaagtgattttcgcccgtcag
cagccgccggtgggcgaatcttccgcaacgcttcgaaaaaacctgtcagacaaccacgca
gagtga

DBGET integrated database retrieval system