Cronobacter sakazakii Sp291: CSSP291_10655 Help Entry CSSP291_10655     CDS       T02461                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism csz  Cronobacter sakazakii Sp291 Pathway csz01100   Metabolic pathways csz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:csz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CSSP291_10655   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CSSP291_10655 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1896 TerB DUF1493 HLH Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AGE86716 LinkDB All DBs Position complement(2213924..2214160) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttccttcgttgaagacctgggcgctgattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system