KEGG   Cronobacter sakazakii Sp291: CSSP291_12395Help
Entry
CSSP291_12395     CDS       T02461                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
csz  Cronobacter sakazakii Sp291
Pathway
csz00020  Citrate cycle (TCA cycle)
csz00190  Oxidative phosphorylation
csz00650  Butanoate metabolism
csz01100  Metabolic pathways
csz01110  Biosynthesis of secondary metabolites
csz01120  Microbial metabolism in diverse environments
csz01130  Biosynthesis of antibiotics
csz01200  Carbon metabolism
Module
csz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
csz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
csz_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:csz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CSSP291_12395 (sdhB)
   00650 Butanoate metabolism
    CSSP291_12395 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CSSP291_12395 (sdhB)
Enzymes [BR:csz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CSSP291_12395 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     CSSP291_12395 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: AGE87062
LinkDB All DBs
Position
complement(2595950..2596666)
Genome map
AA seq 238 aa AA seqDB search
MKLEFSIYRYNPDVDDAPRMQDYTLEQEEGRDMMLLDALMLLKEKDPSLSFRRSCREGVC
GSDGLNMNGKNGLACITPVSSLGAGKQKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPY
LLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETNARLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRSA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgagttttccatttatcgctataacccggatgtcgacgacgcgccgcgcatg
caggattacaccctggagcaggaagaagggcgcgacatgatgctgctcgacgccctgatg
ctgctgaaagagaaggacccgagcctctctttccgccgctcctgccgcgaaggcgtctgc
ggatccgatggcctgaacatgaacggcaaaaacggcctcgcctgtattacgccggtctca
agcctgggcgcgggtaagcagaaaatcgttatccgtccgttgcctggcctgccggttatc
cgcgacctggtagtggacatgggacagttctacgcccaatatgagaagattaagccttac
ttgttgaataatgggcagaatccgccagcgcgtgaacatttgcagatgccggagcaacgc
gagaagctcgacgggctgtacgagtgcattctgtgcgcctgttgctccacgtcgtgcccg
tcgttctggtggaacccggacaagttcatcggcccggcaggcctgctggccgcgtaccgt
ttccttatcgacagccgcgataccgaaaccaacgcgcgcctggatggcctgagcgatgcg
ttcagcgtgttccgttgccatagcatcatgaactgcgtgagcgtctgtccgaaagggtta
aacccgacgcgcgccatcggccatattaagtcgatgttgttgcagcgcagcgcgtaa

DBGET integrated database retrieval system