KEGG   Cronobacter sakazakii Sp291: CSSP291_12780
Entry
CSSP291_12780     CDS       T02461                                 

Definition
(GenBank) alpha-1,6-glucosidase
  KO
K01182  oligo-1,6-glucosidase [EC:3.2.1.10]
Organism
csz  Cronobacter sakazakii Sp291
Pathway
csz00052  Galactose metabolism
csz00500  Starch and sucrose metabolism
csz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CSSP291_12780
   00500 Starch and sucrose metabolism
    CSSP291_12780
Enzymes [BR:csz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.10  oligo-1,6-glucosidase
     CSSP291_12780
SSDB
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase DUF3459
Other DBs
NCBI-ProteinID: AGE87139
LinkDB
Position
complement(2680609..2682264)
AA seq 551 aa
MKAIDKKWWHNAVVYQIYPRSFMDANGDGVGDLAGIISKLDYLQQLGINLIWLSPVYKSP
MDDNGYDISGYDDIAAEFGTMAEMEQLIQEAKARDIYILMDLVVNHTSDEHPWFIEAKKG
KDNPYRDFYIWRKPAPDGGPPNDYRSHFGGSGWAYDEASGEYYLHQFSVRQPDLNWENPR
VQEEIHAMMNRWLDKGIGGFRMDVIDLIGKEVDRQIMANGKHLHVLLRQMNEATFGPRDS
LTVGEAWSATPEDALLYSDPERRELSMVFQFEHIKQTWDEKAGKWRSRPFELPRFKAVID
KWQTALADRGWNSLFWSNHDLPRAVSKFGNDGEFREVSAKMLATALHCLRGTPYIYQGEE
IGMTNVRYSTIEEYRDIESLNFYRELIAGGLTHDEMMTGIYANGRDNARTPMQWDDSPNG
GFTTGTPWLGVNPNYREINVAQALAEPDSILWHYQKLVALRKQYPILVYGDYQMLFAEHP
EVFAWVRRYEGDTLLVINNFFGNAITLPIPEAMQAWHGECLISNYAPRDQLAVSLELQPY
ESFALLIHQEG
NT seq 1656 nt   +upstreamnt  +downstreamnt
atgaaagcaatcgacaagaagtggtggcacaacgcggtggtctatcagatctacccgcgc
agctttatggacgccaacggcgacggcgtgggcgatctggcaggcattatcagcaagctc
gactatctgcaacagcttggcatcaaccttatctggctctcgccggtctacaaatcgcca
atggacgacaatggctacgatatctccggctacgacgatatcgccgcggagttcggcacg
atggcggaaatggaacagctgatccaggaagcgaaggcgcgtgatatctatatcctgatg
gatctggtggtgaaccatacctctgacgagcatccgtggtttatcgaggcgaagaagggc
aaagataacccgtaccgcgatttctatatctggcgcaaaccggcgccggacggcggcccg
ccgaatgattaccgctcgcattttggcggcagcggctgggcgtatgacgaggcgagcggc
gaatattatctgcaccagttttcggtgcgccagccggatctcaactgggaaaacccgcgc
gtgcaggaggagatccacgcgatgatgaaccgctggctggataaaggcatcggcggtttc
cgcatggacgttatcgatttaatcggcaaagaggttgaccggcagatcatggcgaacggc
aagcacctgcacgtgctgctacgccagatgaacgaggcgacgttcggcccgcgcgattcg
ctgaccgtgggcgaagcctggagcgccacgccggaagacgcgctgctctacagcgacccg
gaacgccgggaactctcgatggtgtttcagtttgaacatattaaacagacctgggatgaa
aaagccggtaagtggcgcagcaggccgttcgagctgccgcgctttaaggcggtgattgat
aagtggcagacggcgctggccgaccgcggctggaactcgctgttctggagtaatcatgac
ctgccgcgcgcggtgtcgaaatttggtaatgacggtgagtttcgtgaggtctcggcgaaa
atgctcgccaccgcgctccactgtctgcgcggcacgccctatatctatcagggcgaggag
atcggtatgaccaacgtgcgttactccaccattgaagagtatcgcgacatcgagagcctc
aatttttaccgggaactgattgcaggcggcctgacgcatgacgagatgatgaccggtatc
tacgccaacggccgcgacaacgcccgcacgccgatgcagtgggatgacagcccgaatggc
ggatttaccaccggcacgccgtggctcggcgttaaccccaattaccgcgagattaacgtg
gcgcaggcgctggccgagcctgattccattctctggcactatcaaaagctggtggcgctg
cgtaaacagtatccgattctggtgtatggcgattatcagatgctctttgccgagcacccg
gaagtgtttgcatgggtgcgccgctacgagggcgacacgctgctggtgattaacaatttc
ttcggcaacgccattacgttgcccattccggaagcgatgcaggcgtggcacggcgaatgc
cttatcagtaactatgcgccgcgtgaccagctggctgtgagcctggagctgcaaccttat
gaatcttttgcgctgttaattcatcaggaggggtaa

DBGET integrated database retrieval system