KEGG   Cronobacter sakazakii Sp291: CSSP291_17190Help
Entry
CSSP291_17190     CDS       T02461                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
csz  Cronobacter sakazakii Sp291
Pathway
csz00071  Fatty acid degradation
csz00280  Valine, leucine and isoleucine degradation
csz00281  Geraniol degradation
csz00310  Lysine degradation
csz00362  Benzoate degradation
csz00380  Tryptophan metabolism
csz00410  beta-Alanine metabolism
csz00640  Propanoate metabolism
csz00650  Butanoate metabolism
csz00903  Limonene and pinene degradation
csz00930  Caprolactam degradation
csz01100  Metabolic pathways
csz01110  Biosynthesis of secondary metabolites
csz01120  Microbial metabolism in diverse environments
csz01130  Biosynthesis of antibiotics
csz01200  Carbon metabolism
csz01212  Fatty acid metabolism
Module
csz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:csz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CSSP291_17190 (fadB)
   00650 Butanoate metabolism
    CSSP291_17190 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CSSP291_17190 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CSSP291_17190 (fadB)
   00310 Lysine degradation
    CSSP291_17190 (fadB)
   00380 Tryptophan metabolism
    CSSP291_17190 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CSSP291_17190 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CSSP291_17190 (fadB)
   00281 Geraniol degradation
    CSSP291_17190 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CSSP291_17190 (fadB)
   00930 Caprolactam degradation
    CSSP291_17190 (fadB)
Enzymes [BR:csz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CSSP291_17190 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CSSP291_17190 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CSSP291_17190 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     CSSP291_17190 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AGE88007
LinkDB All DBs
Position
3658898..3661087
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLNWLEDGIAELVFDAPGSVNKLDTATVASLGHALDVLEKQHDLKALLLRSE
KAAFIVGADITEFLSLFQVPAEQLSQWLHFANSVFNRLEDLPVPTLCAINGYALGGGCEC
VLATDFRLATPDARIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIAAGKDITADAALK
VGLVDAVVKPEKLIEGALRMLRQAIDGELDWQARRQPKLEPLRLSKIEATMSFTIAKGMV
MQTAGKHYPAPMTAVKTIEAAAGLGRDEALALENKSFVPLARSSEARALVGIFLNDQYVK
GLAKKLTKETETPKQAAVLGAGIMGGGIAYQSAWKGVPVIMKDINEKSLTLGISEASKLL
NKQLERGKIDGLKLAGVIATIHPTLDYAGFERADVVVEAVVENPKVKKAVLAETEEKVRP
DTVIASNTSTIPISELASVLKRPENFCGMHFFNPVHRMPLVEVIRGEKTSDATIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRQIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDAGRFGQKNGKGFYAYQEDSKGKP
RKVPDDAVDSLLAEVSQPKRAFSDEEIVARMMIPMVNEVVRCLEEGIIASPAEADMALVY
GLGFPPFHGGAFRWLDTQGSAKYLDMAQHYQHLGPLYEAPAGLRDKASHNAPYYPQVEPA
QPVGELQTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctacaaaggcgacaccctgtaccttaactggctggaagacggcattgccgaactg
gtgttcgatgcccccggctcggtgaataagcttgataccgcgaccgtagcaagcctcggc
cacgcgcttgatgtgctggaaaaacagcacgatctcaaagccctgctgctgcgctcggaa
aaagccgcgtttatcgtcggcgctgacattaccgaattcctctcgctgttccaggtgcct
gctgagcaattaagccagtggctgcactttgccaacagcgtatttaaccgtcttgaagat
ctgccggtgccgaccctttgcgccattaacggctacgcgttaggcggcggctgtgaatgc
gtgctggcgaccgatttccgtctcgccacgccggacgcccgcatcggcctgccggaaaca
aaacttggcatcatgccaggctttggcggctcggtacgcctgccgcgcctgctgggtgct
gacagcgcgctggaaattatcgcggccggtaaagacatcaccgccgacgcggcgctgaaa
gtgggcctagttgatgcggtcgtgaaaccggaaaaactgatcgaaggcgcgctgcgtatg
ctgcgccaggccatcgacggcgagctcgactggcaagcccgccgccagccgaagcttgaa
ccgctgcgcttaagtaaaatcgaagcgactatgagctttactatcgccaaaggcatggtg
atgcagaccgcgggcaagcactacccggcaccgatgacggcggtgaaaaccatcgaagcg
gccgcagggctgggccgtgatgaagcactggcgttggagaataaaagctttgtgccgctg
gcgcgttccagcgaagcacgcgcgctggtcggcatctttttaaacgaccagtacgtcaaa
ggccttgcgaaaaaactgaccaaagagaccgagacgccgaaacaggccgcggtactgggc
gcaggcattatgggcggcggcatcgcttaccagtctgcctggaaaggcgtgccggtcatt
atgaaagacattaatgagaaatcactgacgctcggcatcagcgaagccagcaagctgctg
aataaacagctggagcgcggcaaaatcgacgggctgaagctcgcaggcgttatcgccacc
atccatccgacgctggattacgccggctttgagcgcgctgacgtggtcgtcgaggcggtg
gtcgaaaacccgaaggtgaaaaaagcggtgctggcggaaaccgaagaaaaagtccgcccg
gataccgtaattgcctccaatacctcgacgattcctatcagcgagctggcaagcgtgctg
aagcgcccggaaaatttctgcggcatgcacttctttaacccggtgcaccgtatgccgctg
gttgaagtgatccgcggcgagaaaacctccgacgccacgatcgcgaaagtggtggcctgg
gccagcaaaatgggcaaaacgccgattgtggtgaatgactgtcctggcttcttcgttaac
cgcgtgctgttcccctactttgccggtttcagccagctgctgcgcgacggcgctgatttc
cgccagatagacaaagtgatggagaaacagttcggctggccgatgggcccggcgtacctg
ctggatgtcgtcggcatcgataccgcgcaccacgcgcaggccgtgatggcggcgggcttc
ccgcaacgcatgcaaaaagattaccgcgatgctatcgacgcgctgtttgacgccggtcgc
ttcggacagaaaaacggtaaaggtttctatgcctatcaggaggacagcaaaggcaaaccg
cgcaaagtgccggatgacgcggtggacagcctgcttgccgaagtgagccagccgaagcgc
gcgttcagcgatgaagagatcgtcgcacgcatgatgatcccgatggtcaacgaagtggtg
cgctgcctggaagaaggcattatcgccagccccgccgaggcggatatggcgctggtctac
ggtctcggcttcccgccgttccacggcggcgcgttccgctggctggatacgcagggcagc
gcgaaatacctcgatatggcgcagcactatcagcatctcggcccgctttatgaagcgcca
gcggggcttcgcgataaagcgagccacaacgcgccttattatccccaggttgaacctgcc
caaccggtaggcgaactgcaaacggcttaa

DBGET integrated database retrieval system