KEGG   Cronobacter sakazakii Sp291: CSSP291_19715Help
Entry
CSSP291_19715     CDS       T02461                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
csz  Cronobacter sakazakii Sp291
Pathway
csz00250  Alanine, aspartate and glutamate metabolism
csz00410  beta-Alanine metabolism
csz00640  Propanoate metabolism
csz00650  Butanoate metabolism
csz01100  Metabolic pathways
csz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:csz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CSSP291_19715
   00650 Butanoate metabolism
    CSSP291_19715
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CSSP291_19715
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CSSP291_19715
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:csz01007]
    CSSP291_19715
Enzymes [BR:csz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CSSP291_19715
Amino acid related enzymes [BR:csz01007]
 Aminotransferase (transaminase)
  Class III
   CSSP291_19715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGE88504
LinkDB All DBs
Position
4218416..4219681
Genome map
AA seq 421 aa AA seqDB search
MKNSELNQRRQSATPRGVGVMCGFYAEKADNATLWDVEGNEIIDFAAGIAVLNTGHRHPR
VVEAIENQLRAFTHTAYQIVPYESYVALAERINACAPIDGPAKTAFFTTGAEAVENAVKI
ARAYTRRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVFHAQYPNALHGVSVD
DAMASLERIFKADIAPDQVAAIVLEPVQGEGGFNVAPPAFMEALRALCDEHGILLIADEV
QSGFARTGKLFAMEHYGVKPDLLTMAKSLAGGMPLSGVVGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIEQENLCQRANELGQHLQEVLNQARTYCPAIAEVRGQGSMVAVEFND
PQTGKPSPEFTQQVLTRAREEGLLLLSCGVYGNVIRFLYPLTIPDAQFSKALEILSRALG
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaattcagaattgaaccaacgtcgtcagagcgccaccccacgtggcgtcggcgtc
atgtgcggcttctatgccgaaaaagccgacaacgccaccctgtgggacgtggaaggcaac
gagattatcgacttcgcagcgggtattgcggtgctgaacaccggccatcgccatccgcgc
gtggtggaggccatcgaaaaccagctgcgcgcctttacgcatacggcgtaccagatagtt
ccttacgaaagctatgtggcgctcgcggagcgcatcaacgcctgcgcgccgattgacggc
ccggcgaaaaccgcgttcttcaccaccggcgcggaagcggtggaaaacgccgtgaaaatc
gcgcgcgcgtatacccgtcgccctggcttaatcaccttcggcggcggctttcacgggcgc
acgtttatgacgatggcgctcaccggcaaagtggcaccgtacaaaatcggcttcggcccg
ttcccgggctctgtattccacgcgcaatacccgaacgccctgcacggcgtgtcggtggac
gacgcgatggcaagccttgagcgtattttcaaagccgatatcgcgccggatcaggtggcg
gccattgtgctggagccagtgcagggcgaaggcggtttcaacgtcgcgccgccggcgttt
atggaggccctgcgcgcgctgtgcgacgagcacggcattctgctgattgccgatgaagtg
cagagcggttttgcgcgcaccggcaaattgttcgcgatggagcattacggcgtgaagccg
gatctgctgacgatggcgaaaagcctcgcgggcgggatgccgctctcgggcgtggtgggg
cgcgcggaggtgatggacgcgcctgcgccgggcggccttggtggcacctacgccggtaac
ccgctggcagtcgcggcggcgcacgcggtgctggatgtgattgagcaggaaaatctctgc
cagcgcgcgaacgagctgggccagcatctgcaagaggtgctcaaccaggcacgcacctac
tgcccggcgattgccgaagtccgcgggcagggctcgatggtggcggtagagtttaacgat
ccgcagaccggcaagccgtcgcctgagtttacgcagcaggtgctgacgcgcgcccgagaa
gaggggctgctgctgctgagttgcggcgtttacggcaacgttatccgtttcctttacccg
ctgaccatcccggatgcgcagttcagcaaagcgctggagatcctttcccgcgcgctgggg
cgctaa

DBGET integrated database retrieval system