KEGG   Clostridium taeniosporum: BGI42_14270Help
Entry
BGI42_14270       CDS       T04957                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
ctae  Clostridium taeniosporum
Pathway
ctae00030  Pentose phosphate pathway
ctae01100  Metabolic pathways
ctae01110  Biosynthesis of secondary metabolites
ctae01120  Microbial metabolism in diverse environments
ctae01130  Biosynthesis of antibiotics
ctae01200  Carbon metabolism
ctae01230  Biosynthesis of amino acids
Module
ctae_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:ctae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BGI42_14270
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    BGI42_14270
Enzymes [BR:ctae01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     BGI42_14270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C PFOR_II DUF3343 Rpp20
Motif
Other DBs
NCBI-ProteinID: AOR24817
UniProt: A0A1D7XNF9
LinkDB All DBs
Position
complement(3199988..3200914)
Genome map
AA seq 308 aa AA seqDB search
MKRATRESYGATLAQLGNENKNIVVLDADLSKATKSEIFAKAHPDRFINVGIAEQNMIGM
AAGLANGGKIPFATTFAVFAAGRAFEVIRNSVCYPNVNVKIAATHAGITVGPDGGSHQAI
EDIALMSSLPNMIVLSPADDIEACKCIKVAAEIKSPVYIRLGRIALDDIYTEDYNFKIGK
GNTIVEGNDVSIIATGIMVHKALKAAKELKEEGINARVINISTIKPIDEEIIIKAAKETK
GIVTVEEHSIIGGLGDRVASVVCDNYPTKVKKIGVKDVFGESGDPDGLLEKHGLTVENIK
KVSKELVK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagagcaactagagaatcatatggagcaactttagctcaattgggaaatgaaaat
aaaaatatagtagtgttagatgcagatctttcaaaagctactaaatcagaaatttttgca
aaagcacatccagatagatttattaatgttggtatagctgaacaaaacatgattggtatg
gcagcaggtcttgctaatggtggaaaaataccttttgctactacttttgcagtatttgca
gcaggtagagcatttgaagtaataagaaactcagtatgttatccaaatgttaatgttaaa
atagctgccactcatgcaggaataacagtaggtccagatggtggttcacaccaagcgata
gaagatattgctcttatgtcatcattacctaatatgatagttttatcacctgctgatgat
attgaagcttgtaaatgcattaaagtagcagcagaaattaaatctccagtttatataaga
ttaggtagaattgcattagatgatatatatacagaagattataattttaaaataggaaaa
ggaaatactatagtagaaggaaatgatgtatctattattgccactggaataatggttcat
aaagcattaaaagcagctaaagaacttaaagaagaaggtataaatgctagagttataaat
atttctactattaaacctatagatgaagaaataataataaaagcagctaaagaaacaaaa
ggaattgtaacagttgaagaacattcaataataggcggattaggagatagagtagcaagt
gtagtttgtgacaattatccaactaaggtaaaaaaaataggtgttaaagatgtatttgga
gaatctggagatccagatggattactagaaaaacacggattaacggttgaaaacattaaa
aaagtttctaaagaattagttaaatag

DBGET integrated database retrieval system