KEGG   Chryseobacterium taklimakanense: 4412677_00061Help
Entry
4412677_00061     CDS       T05512                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ctak  Chryseobacterium taklimakanense
Pathway
ctak00620  Pyruvate metabolism
ctak00680  Methane metabolism
ctak01100  Metabolic pathways
ctak01120  Microbial metabolism in diverse environments
ctak01200  Carbon metabolism
Module
ctak_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ctak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    4412677_00061 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    4412677_00061 (ppc)
Enzymes [BR:ctak01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     4412677_00061 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: SNV31799
UniProt: A0A239WC64
LinkDB All DBs
Position
1:63529..66072
Genome map
AA seq 847 aa AA seqDB search
MLNEQLKEKFRQVVENKFQIYNSLFMSLPYDKMTNIGMLLPFLYEESKAGYEAGKDPLQI
VEEFFTKHTELRTEEQKLELLFKIIQYIERQVVLFDSIEDAAFSKLHSESDAGTVMQLHE
RSVQENKLDEIRAKMKDFAVRVVFTAHPTQFYPNAVQGILHDLRGAIMEDSVTEIDTLLQ
QLGKTPFVNKEKPTPLDEARSIIYYLRYVYYDTIGELYKKLKNRFGTKDYVPNPNIVQLG
FWPGGDRDGNPFVTADITLKVAEELRGNILKCYYGHLKNLRRRLSFRGITEILEELSQQL
YHSIFHSEELISAEEILSKINAAEKILDEYHNGLFRELLDDFRDRVKIFGTHFATLDIRQ
DSRVHQQVVDSIISKKSDLNVENLSSEDKLKWLLETDIVLDPAEFESITKETLQSVINVK
EIQKKNGERGMHRYIISNSDEIKDVLYVYAFFKLCGYKVEDINIDIVPLFETIEGLGNAQ
DVMRQLYELPLYKKHIEKRGNYQTIMLGFSDGTKDGGYLKANWEIYETKEHLTKISEEYG
IKVIFFDGRGGPPARGGGKTHDFYASQGKTIANHKIEITIQGQTITSVFGNKDQAKYNFE
QLLTAGLENDVFKNSAKDLAENERRLLQELAEISFKKYSDLKSHPMFVPYLQEMSTLQYY
GRTNIGSRPTKRGSGNELKFEDLRAIPFVGSWAQLKQNVPGFFGFGFALNEMKKSGRFDE
VKALYKGSDFFRTLVLNSMMSMNKSYFPLTSYMKNNRKFGGFWNILNDEYELSKKMMLEL
TGFEMLQQEEPLSRKSVKIREKIVLPLLSIQQYALMKIQKGEGNTEAYEKLVTRSLFGNI
NASRNSA
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgctaaacgaacagttaaaagaaaaattccggcaggtagtagagaataaattccagatt
tataactcccttttcatgagcctgccatacgataaaatgaccaatatcgggatgctgctc
ccatttttatacgaagaaagcaaagccggttacgaagccgggaaagatccgctgcagatt
gtggaagaattctttaccaaacataccgaactgcggaccgaggagcagaaacttgaactt
ttgtttaagatcatccagtacatcgagagacaggttgtgctttttgacagtatcgaggat
gccgctttctcaaagctgcattccgaaagcgatgccgggacggtgatgcagctccacgaa
cgcagtgttcaggaaaacaagctggacgaaattcgtgcaaagatgaaggattttgcggta
agagtggttttcactgcgcacccgactcagttttatcctaatgctgttcaggggattctg
cacgatctgcgcggcgcaattatggaagattccgtcactgaaatcgatacgcttctgcag
cagttaggcaaaacgcctttcgtaaacaaggaaaagccaacgccattggacgaagccagg
agcatcatttattatttgcgctatgtttattacgataccatcggcgaactttataagaaa
ctcaaaaaccgcttcgggaccaaagattatgttccaaatcccaatattgtgcagcttggc
ttctggcccggtggcgaccgcgacggaaatccttttgtgacggctgatattacgctgaaa
gttgcagaagagcttcggggaaatattcttaaatgttattacggacatctcaagaacctg
cggagaagattgagtttccggggcattacagaaattttggaagagctgagccagcagctt
taccacagtatttttcattcagaagaactgatttctgcggaggaaattctttcgaaaatc
aatgcggctgaaaaaattcttgatgagtatcacaatggtctgttcagggaacttctggat
gatttccgcgaccgggtgaaaattttcgggacgcatttcgccactttggatattcgccag
gacagccgggttcaccagcaggttgttgacagcatcatttcaaaaaaatcagatttaaat
gttgaaaatttaagttctgaagacaaactgaaatggcttctggaaaccgatattgttctt
gatcctgcagaatttgagagcattaccaaagaaacactgcaaagcgttatcaatgtaaaa
gaaatccagaaaaaaaatggggagcgcggcatgcacaggtacatcatttcaaactcggat
gagatcaaggatgtgctgtatgtttacgccttcttcaaactttgcggctacaaagtcgaa
gatatcaatatagacattgttccgctttttgaaaccatcgaaggactcgggaatgctcag
gacgtgatgcggcagctttatgaacttccactttataaaaaacatatcgaaaaacgcgga
aattatcagacgatcatgctcggcttttccgacggaaccaaagatggcggctacctgaaa
gcaaactgggaaatctacgaaaccaaggaacacctcaccaaaatctctgaggaatatggc
attaaagtgattttctttgacggcaggggcgggccaccggcaagaggcggcggcaaaact
cacgatttttacgcatcgcaggggaaaaccattgccaatcataagattgaaatcacaatt
caggggcagacgattaccagcgttttcggaaacaaagaccaggcgaaatataattttgag
cagctcctgacggccggacttgaaaatgatgtatttaaaaattcagcgaaagacctggcc
gaaaatgaacgccggcttttgcaggaactcgcagaaatcagttttaaaaaatattctgat
ctgaaaagtcatccgatgtttgtgccataccttcaggaaatgagcaccctgcagtattac
ggcagaaccaatatcggaagtcggccaaccaaacgtggcagcggaaatgagctgaaattt
gaggatttgcgggccatacctttcgtaggctcgtgggcgcagcttaaacagaatgttccg
ggattttttggttttggctttgctttgaatgaaatgaaaaaatcaggaaggtttgacgaa
gtgaaagccctttacaaaggttccgacttcttccggactttggttttgaattcgatgatg
agtatgaataaatcgtatttcccgctgacatcttacatgaaaaacaacaggaagtttggc
ggtttctggaatattctgaatgatgaatatgaactttcaaagaaaatgatgctggaactt
accggttttgaaatgctgcaacaggaagaacctttatctaggaaatctgtaaaaatcagg
gaaaaaatcgtgctgccgttattaagtattcagcagtatgccctgatgaaaattcaaaaa
ggagagggcaacacagaagcctacgaaaaactggtgacgcgctcgctgtttggaaatatt
aatgccagccgcaattctgcttaa

DBGET integrated database retrieval system