KEGG   Chryseobacterium taklimakanense: 4412677_00744Help
Entry
4412677_00744     CDS       T05512                                 

Definition
(GenBank) Putative DNA ligase-like protein Rv0938/MT0965
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ctak  Chryseobacterium taklimakanense
Pathway
ctak03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ctak00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    4412677_00744
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ctak03400]
    4412677_00744
Enzymes [BR:ctak01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     4412677_00744
DNA repair and recombination proteins [BR:ctak03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     4412677_00744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2 mRNA_cap_enzyme Alpha_TIF
Motif
Other DBs
NCBI-ProteinID: SNV38093
UniProt: A0A239WVV8
LinkDB All DBs
Position
1:747062..749602
Genome map
AA seq 846 aa AA seqDB search
MSLKEYNEKRDFKQTAEPEGIAETSGEKLRFVVQRHAASHLHYDFRLEMDGVLKSWAVPK
GPSLNPKDKRLAMHVEDHPFSYRTFEGTIPKGNYGAGEVEIWDEGWYEPLNKIKGKTDDM
VMRAELHRESLKFIMHGKKLQGEFALVKIKNSADGKSWLLIKHKDEFATEFYDAEEHTAK
NSKVTAALHKKDGEKVSESTGKTYRNYAPALSKEKKLKQFIEPMLAKNSDNKPFDGKDWA
FEIKWDGYRAVADLRDGIQLYSRNGLDFSGKFKKIVNQLGLQEHEMVLDGEVVAYDDKGK
PNFQWLQNIGERPNVNLIYQVFDILFLNGHSTRSLSFLERKELLKGALKETENIKYCDHI
LEKGKEFFRLAEDMGLEGIIAKKTESTYTDGIRSSEWIKVKTQQTDEVIICGYTEPKGAR
KNFGSLILGQFQDGELTFSGHIGTGFSDKTLKELFELMKPLVTDQSPFKKIPKTNEKPTW
LKPELIAEIKYSEKTKDGIFRHPVFLHLREDKVVEDVKSDEQIPEETMEKETPKAVKKEP
AARENESKTKIGKQEVKLTNQNKIYFPKDGVTKGDVVAYYQSVAEFILPHLKNRAQSLNR
FPNGIDGMSFYQKDAADETPDWIETHKIYSDSNDKYINYIICNDAATLAYLNNLGCIEMN
VWTSRIDDIENPDYLVLDLDPSDNNTFDDVIVTANEVKKILDKAKIEGYPKTSGSSGIHV
YIPMGSEYSFEQVKNFGHVLMQQVQQNLPDITTLERSLQKRDKNKIYLDYLQNRRGQTLA
SVYSLRPKNGAPVSMALEWKEVKSGLKPTDWNIENALARIEKKGDLFLPTLNKGIDMLKA
IENLQK
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atgtcactaaaagaatacaacgaaaagcgtgatttcaagcagactgcagaacccgaaggc
attgccgagacttctggcgagaaactccgttttgtggttcagcggcatgcggcgtcgcat
ctgcattacgacttccggctggaaatggacggggtgctgaaaagttgggccgttccaaaa
ggcccgtcattaaaccccaaagacaaacgccttgcaatgcatgtggaagatcatcctttt
tcttaccgcactttcgagggaacaataccgaaaggaaattacggcgccggtgaagtagaa
atttgggatgaaggctggtatgaacctttaaacaaaataaaaggcaaaaccgatgacatg
gtcatgcgcgccgaactgcacagggaaagcctgaaattcatcatgcacggcaaaaaactg
cagggcgaatttgctctggtaaaaattaaaaactctgccgacggtaaatcctggctgctc
atcaaacataaagacgaatttgcgaccgagttttacgatgctgaagaacacaccgccaaa
aactcaaaagttactgcagcactccataaaaaagacggagaaaaggtttctgaaagcact
ggaaaaacttaccggaactacgcccctgctctttctaaagaaaagaagctgaagcaattc
atcgagcctatgctggcaaaaaattcggacaataaaccttttgacggcaaggactgggct
tttgaaataaaatgggacggttaccgcgcggttgcagatctgcgcgacggaatacagttg
tactcgaggaacggactggatttttctggaaaattcaaaaaaattgttaaccagttgggt
ttgcaggagcacgaaatggtcttagacggcgaagttgtagcgtatgatgacaaaggaaaa
ccgaatttccagtggctgcagaatattggtgagcggccaaatgtgaacctgatttaccag
gtctttgatattttatttttaaatggccactccaccagaagtttaagcttcctcgaacgg
aaagaacttcttaaaggcgcactgaaagaaacggagaatatcaaatactgcgaccacatc
ctcgaaaaaggaaaagagtttttccggcttgccgaagatatgggtttggaaggcatcata
gccaaaaaaacggaaagcacatacaccgacggcatccgaagttcggaatggattaaggtg
aaaacgcagcaaaccgatgaagtcatcatttgtggatacactgaaccgaaaggcgccaga
aaaaactttggctccctgattctcggacagtttcaggatggtgaacttaccttttccggc
cacatcggaaccggattttcagataaaaccttaaaggaactttttgaactgatgaagcct
ttggtaacagatcaatcacctttcaaaaaaatcccgaaaaccaacgaaaaaccaacctgg
cttaaacctgaacttatcgccgaaatcaaatattctgaaaagactaaagacggcattttc
agacatcctgttttcctgcatttaagggaagacaaagtggttgaagatgtgaaaagtgac
gaacaaatccccgaggagaccatggaaaaggagacaccaaaagccgtaaaaaaagaacct
gcagcaagagagaacgaatctaaaacaaaaattggcaaacaggaagtaaaactgaccaac
caaaacaaaatttatttcccgaaagacggtgttaccaaaggtgatgtggtggcatattac
caaagcgtggcagaattcattttacctcaccttaaaaaccgagcacagtctttaaatcgt
ttcccgaacggtattgacggaatgagtttctaccagaaagacgccgccgatgaaactccc
gactggattgaaacccacaaaatatattccgacagcaatgataaatacatcaattatatc
atctgtaacgatgctgccaccctcgcctacctcaacaatttgggctgcattgaaatgaat
gtctggacgagcagaattgatgatatcgaaaatccggattacctcgttctagacctcgat
ccctctgacaataatacttttgacgacgtcatcgtgaccgcaaacgaagtaaaaaagatt
ttagataaagcaaaaatagaagggtacccgaaaacttccggaagttcgggcatccatgtt
tatattccaatgggcagcgaatattcttttgaacaggttaaaaattttggccacgtcctg
atgcagcaggttcagcaaaaccttcctgatatcacaaccctggaaagaagccttcagaaa
agggacaagaataagatctaccttgattatctgcaaaaccgccgcggacaaacattggcg
agtgtttacagtttaaggccgaagaacggtgcgcccgtttcaatggctttggaatggaaa
gaagtgaaatccggacttaaacccaccgattggaacatcgaaaatgctttggcgagaatc
gagaaaaaaggcgacctgtttcttccgaccttaaataaaggaatagacatgctgaaggcc
attgaaaaccttcagaaatag

DBGET integrated database retrieval system