KEGG   Chlamydia trachomatis 434/Bu: CTL0359Help
Entry
CTL0359           CDS       T00645                                 

Gene name
fabI
Definition
(RefSeq) enoyl-(acyl carrier protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
ctb  Chlamydia trachomatis 434/Bu
Pathway
ctb00061  Fatty acid biosynthesis
ctb00780  Biotin metabolism
ctb01100  Metabolic pathways
ctb01130  Biosynthesis of antibiotics
ctb01212  Fatty acid metabolism
Module
ctb_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ctb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CTL0359 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CTL0359 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CTL0359 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ctb01004]
    CTL0359 (fabI)
Enzymes [BR:ctb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CTL0359 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CTL0359 (fabI)
Lipid biosynthesis proteins [BR:ctb01004]
 Fatty acid synthase
  Component type
   CTL0359 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-GeneID: 5858016
NCBI-ProteinID: YP_001654443
UniProt: A0A0H3MCZ2
LinkDB All DBs
Structure
PDB: 

Position
complement(441667..442563)
Genome map
AA seq 298 aa AA seqDB search
MLKIDLTGKIAFIAGIGDDNGYGWGIAKMLAEAGATILVGTWVPIYKIFSQSWELGKFNA
SRELSNGELLTFAKIYPMDASFDTPEDIPQEILENKRYKDLSGYTVSEVVEQVKKDFGHI
DILVHSLANSPEIAKPLLDTSRKGYLAALSTSSYSFISLLSHFGPIMNAGASTISLTYLA
SMRAVPGYGGGMNAAKAALESDTKVLAWEAGRRWGVRVNTISAGPLASRAGKAIGFIERM
VDYYQDWAPLPSPMEAEQVGAAAAFLVSPLASAITGETLYVDHGANVMGIGPEMFPKD
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaattgatttaacaggaaaaattgctttcatagccggcataggcgatgataac
gggtatggctggggcattgccaaaatgttagcagaagcaggcgcaaccatacttgtgggg
acctgggttcctatctataaaattttctctcaatcttgggagttaggaaaattcaatgca
tctcgtgaactctccaatggagaattgctaactttcgctaaaatctatcccatggatgcc
agtttcgacaccccagaagatattcctcaggaaattttggaaaataaacgttacaaagat
ctttctgggtacactgtatccgaagttgtagaacaggtgaaaaaagattttggacacatt
gatattcttgttcactctttagcaaacagtccggaaattgctaaaccattacttgatacc
tctcgtaaaggctatcttgccgccttaagtacatccagctactcctttatcagccttctc
tctcattttggcccaattatgaatgcaggagctagcaccatctctctaacttatcttgct
tccatgcgtgctgttccagggtatggcggaggaatgaacgcagcaaaagctgctttagaa
agtgatacaaaagtactggcttgggaagccggccgacgttggggagtccgagtgaatact
atctcggcagggccattagctagccgtgcaggaaaagctattggatttattgagagaatg
gtggattactaccaagactgggctccactaccttctccaatggaagctgagcaagtaggc
gcagcagcagccttcttagtctctcccctagctagcgcaattacgggagaaactctctat
gtggatcacggagccaatgtgatgggcataggtccagaaatgtttcctaaggattaa

DBGET integrated database retrieval system