KEGG   Chlamydia trachomatis L2/434/Bu: CTL0546Help
Entry
CTL0546           CDS       T00645                                 

Gene name
sodM
Definition
(RefSeq) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ctb  Chlamydia trachomatis L2/434/Bu
Brite
Enzymes [BR:ctb01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CTL0546 (sodM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_N Sod_Fe_C Imm3
Motif
Other DBs
NCBI-GeneID: 5858610
NCBI-ProteinID: YP_001654623
UniProt: A0A0H3MKY6
LinkDB All DBs
Position
complement(645896..646516)
Genome map
AA seq 206 aa AA seqDB search
MVFSSYMLPALPYDYDALEPVISAEIMQLHHQKHHQGYINNLNEALKSLDVANATQDLTR
LIAINPALRFNGGGHINHSLFWEMLAPQGKGGGVPPRHELLKLIEKFWGSFDSFLKNFIA
SSAAVQGSGWGWLAFCPKKQELVVQTTANQDPLEATTGMIPLLGVDVWEHAYYLQYKNVR
IDYLKSFPSIINWDYIENRFVEMSKQ
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggtcttttcttcttatatgcttcccgcattgccttatgattacgatgctttagagcct
gtaattagtgctgagattatgcaactgcatcatcaaaagcatcaccaaggatatataaat
aatttgaatgaggccttaaaaagtttagatgtagcaaacgctactcaagatttaacaagg
ctaatcgcaatcaatcctgctctgcgtttcaatggtggagggcatattaaccactctctt
ttctgggagatgcttgcgcctcaagggaaaggagggggagttcctcctcgtcatgaatta
ctaaaattaatcgaaaaattctggggctctttcgatagttttttaaaaaattttattgct
tcttctgctgcagtgcaaggatctggctggggatggttagctttttgtcccaaaaaacaa
gagcttgtggtacagaccacagcaaaccaggatcctctagaggcgacgaccgggatgatc
cctctcctaggagtagatgtgtgggagcacgcatattatctccagtataaaaatgtgaga
atagattatctaaaaagtttcccgagcataattaattgggattatatagagaatcgcttt
gtagaaatgagcaagcaataa

DBGET integrated database retrieval system