KEGG   Chlorobaculum tepidum: CT1211Help
Entry
CT1211            CDS       T00088                                 

Gene name
sodB
Definition
(RefSeq) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cte  Chlorobaculum tepidum
Brite
Enzymes [BR:cte01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CT1211 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N MPM1
Motif
Other DBs
NCBI-GeneID: 1006571
NCBI-ProteinID: NP_662101
CyanoBase: CT1211
CYORF: CT1211
UniProt: Q8KD44
LinkDB All DBs
Position
1136928..1137530
Genome map
AA seq 200 aa AA seqDB search
MAYQQPALPYADNALEPHISANTIGFHYGKHHAAYVKNYNGFVEGTPYDAMSLEEVIIQT
ASDASKTGIFNNGAQAWNHSFYWNCLTPNGGGEPTGEIATKITEDFGSVDKFKEELKNAA
ATQFGSGWAWLVLDGGKLKVTKTGNAQNPMTSGQTPLLCIDVWEHAYYLDYQNRRPDHVA
AVIENLINWEFINANYAAAK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcatatcagcaacctgcactcccctacgccgataacgcgctcgaaccgcatatctct
gccaataccatcggctttcactacggcaagcaccatgcggcctacgtcaaaaactacaac
ggtttcgtcgaaggcacgccatatgacgccatgagtctcgaagaggtgatcatccagacg
gcaagtgacgcctcgaagactggcatattcaacaatggcgcgcaggcatggaaccacagc
ttctactggaactgcctcactccgaacggcggcggcgagccaaccggcgaaatcgccacg
aaaatcaccgaagatttcggcagcgttgacaagttcaaagaggagctgaaaaacgccgct
gcaacccagttcggtagcggctgggcctggctggtgctcgatggcggcaagctcaaggta
accaaaaccggcaacgcccagaacccgatgacctccggccagaccccgctgctctgcatc
gacgtctgggaacacgcctactacctcgattaccagaaccgccgccccgaccacgtggcc
gccgtgatcgaaaacctgatcaactgggagttcatcaacgctaattacgctgcggcgaaa
taa

DBGET integrated database retrieval system