KEGG   Chlorobaculum tepidum: CT2088Help
Entry
CT2088            CDS       T00088                                 

Gene name
treS
Definition
(RefSeq) trehalose synthase
Organism
cte  Chlorobaculum tepidum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap APH Transcrip_act
Motif
Other DBs
NCBI-GeneID: 1007474
NCBI-ProteinID: NP_662963
CyanoBase: CT2088
CYORF: CT2088
UniProt: Q8KAR7
LinkDB All DBs
Position
complement(1978406..1981732)
Genome map
AA seq 1108 aa AA seqDB search
MPKKQAVTSYQPESLWYKDAIIYELHVKTFCDSDNDGIGDFRGLKSRLGYLESLGVTAIW
ILPFYPSPLRDDGYDIADYKSVNPDYGTIEDFRDFLEEAHRRGIKVITELVVNHTSDQHE
WFKKARKAPKGSPERDFYVWSDDPTKYGEARIIFQDFEASNWTWDPVAGQYYWHRFFHHQ
PDLNFENPAVHQALFDVLDFWLGMGVDGLRLDAVPYLYEAEGTNCENLPQTFEFLRKLRS
YVDEHYPNRMLLAEANQWPEDSAAYLGKGDMCHMNFHFPLMPRMYMALATEDRFPIIDIL
AQTPEIPESCQWASFLRNHDELTLEMVTDEERDYMRRVYAHDVKARINLGIRRRLAPLMS
NDRRRIELMNIMLLSLPGTPVLYYGDEIGMGDNYYLGDRDGVRTPMQWNADRNAGFSRAN
PQRLLLPVIIDPEYHYEAVNVEVQESNPNSLLWWMRHTIATARRFRAFSRGTIEFLNANN
PKVLMFIRSYEDETILTVINLSRNAQVINVDLSAYEGCVPEEIFSMNRFPRVHKTPYMVA
LGPYGYFWLRLIREESPADRSALLEKVALRAGSWQELFVGRSLDQFETAILPPYYKSVRW
FGGKARNIIRIRVTDTVPVAGMENTAFAMTEVNYPSGENERYQLPLTFVPVERGNLADEL
FYRHAIARVELDGLEGFLIDASADETFRSRLLDLILHRETWSGAAGKITADAGKMLENSC
LSTAGEEPPASHLMGLEQSNTSIRYGEQLCLKLYRKIDSGMAPEIEISRVLTDQTEYRNI
PVYLGSFDYGKSYRERCSLGILQNFVPNESDGWQLSLGHVRRYYEDVLSRCSQGVLPPTL
PELSGTTSKLPELIHELIGEFYFQMVGKLAERTAGMHRALGSVDTDAAFSPEPFTTLYQR
SIYQAMTDQVKRSMIFLRESIHAVPKEARPLAHKLLDMQKEILEQFEPIRKEKIDTVKIR
IHGDYHLGQVLYTGNDFVILDFEGEPARSLSERKIKRSVYRDLAGMLRSFDYAAFNVLMQ
NQAIRPEDRKALEPWAELWSYYVGQHFIDVYTQQTEGSGLIPKEPRQRELLLRSYLMNKA
IYELNYELNNRPEWLPIPMNGILRLIRN
NT seq 3327 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaaaaacaagctgtaacaagctatcagccggagtcgctctggtacaaggatgcc
attatttatgaactacatgtcaaaaccttctgtgacagcgataacgatggcatcggtgat
tttcgcggcctgaagagccgcctcggctaccttgaaagcctcggagtgacggcgatctgg
attctgccgttctacccctcgccactgcgcgacgacggctacgacatcgccgattacaag
tcggtcaatcccgactacggcacgatcgaggatttccgcgacttcctcgaagaggcgcat
cggcgcggcatcaaggtgattaccgagctggtggtgaaccacacctccgaccagcacgag
tggttcaaaaaagcccgcaaggctccgaaagggtcgccggagcgcgacttttacgtctgg
agcgacgacccgacgaagtatggcgaggcgcgcattattttccaggacttcgaggcttcg
aactggacctgggatcccgtggctggccagtactactggcaccgctttttccatcaccag
cccgacctgaacttcgagaatcccgccgtgcaccaggcgctgttcgacgtgctcgatttc
tggctcggcatgggagtggatggcctgcggcttgatgccgtaccctacctctacgaggct
gaaggcaccaactgtgagaacctgccgcagaccttcgagttcctgcgcaagctgcgctct
tatgtggacgagcattatcccaaccggatgcttcttgccgaggctaaccagtggccggag
gactccgccgcctatcttggcaagggggacatgtgccacatgaacttccatttcccgctc
atgccgcgcatgtatatggcgctggctaccgaggatcgttttccgatcatcgacattctc
gcccagacgcccgaaattccggagagctgccagtgggcgtcgttcctgcgcaaccacgac
gagctgacgcttgaaatggtgaccgacgaggagcgcgactacatgcgccgcgtttatgcc
cacgatgtcaaggcgcgcatcaacctcggcatccgccgccgcctcgcgccgctcatgtcg
aacgaccgccgccgcatcgagctgatgaacatcatgctgctctccctgcccggtactccg
gtgctctattacggcgacgagatcggcatgggcgacaactactacctcggcgaccgtgac
ggcgtgcgcaccccgatgcagtggaacgccgaccgcaacgcgggcttttcgcgtgccaat
ccgcagcgcctgcttctgccggtgatcatcgaccccgagtaccactatgaagcggttaac
gtcgaggtgcaggagtccaatcccaactcgctgctctggtggatgcgccacaccatcgcc
acggcccgccgcttccgagcgttcagccgcggcaccatcgagttcctcaacgccaacaac
cccaaggtgctgatgtttatccgctcgtacgaagatgaaaccatcctcaccgtgatcaac
ctgtcccgcaacgcacaggtgatcaacgtcgatctttccgcttatgagggatgcgtgccg
gaggagattttcagcatgaaccgcttcccgagagtgcacaaaacaccatatatggtcgcg
ctcggaccatacggctatttctggcttcggctgatccgcgaggagtcgccggcggacagg
tctgccctgcttgaaaaggttgcccttcgtgccggaagctggcaggagctgtttgttggc
cgcagtctcgaccagttcgaaaccgctattctgccaccctattacaagagcgtgcgctgg
ttcgggggcaaagcccgcaatatcatcagaatcagggtgaccgataccgtgccggtcgcc
ggaatggagaacactgcgtttgcgatgactgaagtgaactatccgagtggcgagaatgaa
cgctaccagcttccgctgaccttcgtgccagtggagcgaggtaaccttgcggatgagttg
ttctaccgtcatgccatagcaagggttgaacttgatggccttgaagggttcctcatcgac
gcttcagccgacgagaccttccgttcaaggctgctcgatcttatcctgcacagagagacc
tggtccggcgcagctggcaagatcaccgcggatgccggcaagatgctcgaaaacagttgc
ctctcgaccgccggcgaagagccgcccgcctcgcatctgatgggcctggaacagagcaat
acctcgattcgctacggtgagcagctctgcctgaagctctaccgcaagatcgacagcggc
atggcacccgaaatcgaaatctcccgcgtgctgaccgatcagacagagtaccggaacatt
ccggtctatctcggctcgtttgactacggcaaaagctaccgggagcgctgttcgctcggc
attctccagaatttcgttccgaatgaatccgacggctggcagttgagtctcggccatgtc
cgccggtactatgaggatgtattgtcgcgctgttcgcagggcgtgcttccgccaacgctg
ccggaactttctggcaccacaagcaaactgccggagcttatccatgagctgatcggcgag
ttctatttccagatggtcggcaagcttgctgagcgcacggccggtatgcatcgtgcgctc
ggctctgtcgataccgatgctgctttctcgcccgagccgttcacgacgctctaccagcgc
tccatctatcaggcgatgactgaccaggtcaagcgcagcatgatcttcctgcgtgaatcc
atacacgccgttcccaaggaggcccgtccgcttgcccataagctgctcgatatgcagaag
gagattctcgaacagttcgagccgatccgcaaggagaagatcgacacggtcaagatcagg
attcacggtgactaccatctcggccaggtgctctacaccggtaatgacttcgtgattctc
gatttcgagggcgagccggcccgctcactctcggagcgcaagatcaaacgctcggtctac
cgcgacctcgcgggtatgctgcgttcgttcgactacgcggccttcaacgtgctgatgcag
aaccaggctatccggcccgaagatcgcaaggcgctcgagccgtgggccgagctttggagc
tactatgttggtcagcattttatcgatgtctatacgcagcaaaccgaaggttcgggcctg
attcccaaagagccgcgccagcgtgagctgctcctgcgcagctacctgatgaacaaggcg
atctacgagctgaactacgagctgaacaaccgccccgagtggctgccgattccaatgaac
ggcatcctgcgcctcatccgtaactga

DBGET integrated database retrieval system