KEGG   Corynebacterium testudinoris: CTEST_00190Help
Entry
CTEST_00190       CDS       T03956                                 

Gene name
pknA
Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cted  Corynebacterium testudinoris
Brite
KEGG Orthology (KO) [BR:cted00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cted01001]
    CTEST_00190 (pknA)
Enzymes [BR:cted01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CTEST_00190 (pknA)
Protein kinases [BR:cted01001]
 Serine/threonine kinases: Other
  Bacterial family
   CTEST_00190 (pknA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like Kdo Pkinase_fungal RIO1 PUB_1 Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: AKK07509
UniProt: A0A0G3H266
LinkDB All DBs
Position
complement(37400..38797)
Genome map
AA seq 465 aa AA seqDB search
MANIDGRDRLQNLIGEDYQLQWIIGHGGMSTVWLADDIRNDREVAIKVLRPEFSDNREFL
DRFRNEAATAELIDSDNVVHTYDYREIPDPSGHTFCFIAMEYVRGESLADLLAREKQLDE
SLALDVLEQAAHGLSIIHRMDLVHRDIKPGNLLITQNGQVKITDFGIAKAAAAVPLTRTG
MVVGTAQYVSPEQAQGKEVTAASDIYSLGVVGYEMLAGQRPFTGDSSVSVALAHISQAPP
ALSTGVSAEARELIGIALRKDPTQRFANGNEMALAVSAVRLGNRPPQPKSAAMSQLAPEP
SPTESTRMLGAATNPTTIHPATSVTGAVPAVAPTGQGRRRAEASGGGFGTGVLIAIIIAA
LLGGGAFLAAQMGLFNGISGGTSTTQPVTSEPEVVTEWVTPTEESTPVPTTITQWVTPTS
EEPTPTAEPTPTPTPTQPVAPTPTAPALPTLPELPGLDALTGGNG
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggctaatatcgacggccgcgaccggttgcaaaacctcatcggcgaggactaccagctc
caatggatcatcggccacggaggcatgtccaccgtgtggctcgctgatgacatccgtaac
gaccgcgaagtcgccatcaaggttctgcgcccggagttctccgataaccgcgagttcctc
gaccgcttccgcaatgaagcagccacggcggaactcatcgattccgataacgtcgttcac
acctacgactaccgcgaaattcccgacccttcggggcacaccttctgcttcatcgccatg
gaatacgtccgcggcgaatccctcgctgacctgctggcccgggagaagcagctcgatgag
tccttggctctcgacgtcctcgagcaggccgcccacggcctgtccatcatccaccgcatg
gacctggtccaccgcgatatcaagcccggcaacctgctgatcacccagaatgggcaggtg
aaaatcacggacttcggcatcgccaaggcggccgccgcggtgccgctgacccgcacgggc
atggtcgtgggcaccgcgcagtacgtctcgccggagcaggcgcagggcaaggaagtcacc
gcggcctccgatatttactccctcggtgtcgtcggctacgagatgctcgccgggcagcgc
cccttcaccggcgactcctctgtctccgtcgcgctggcgcacatcagccaggctccccca
gccctgtccaccggcgtgagcgccgaggcccgcgagctcatcggcatcgccctgcgcaag
gacccgacccagcgcttcgccaacggcaacgaaatggccctggcggtgtccgccgtgcgc
ctgggcaaccgaccgccgcagccgaagtcggcagcgatgtcccagctcgcgcccgagccc
tccccgaccgaatccacccggatgctcggcgccgccacgaacccgacgacgattcacccg
gccacctccgtcaccggtgccgtgcccgcagtcgcccccaccggccagggacgacgccgc
gcggaagcctccggcggtggcttcggcaccggcgtcctcatcgccatcatcatcgccgcc
ctcctcggcggcggcgccttcctggccgcgcagatgggcctgttcaacgggatctccggg
ggcacctccacgacgcaaccggtcaccagcgaacccgaggttgtcaccgagtgggtcacc
ccgacggaggaatccaccccggtccccaccaccatcacccagtgggtcacgccgacgtcc
gaggaaccgacgcccacggcggagcccacacccaccccgacgccgacccagcccgtcgcg
cccacgccgacggcccccgcgttgcccaccctcccggagctccccggcctggacgccctc
acgggaggtaacggatga

DBGET integrated database retrieval system