KEGG   Corynebacterium testudinoris: CTEST_01975Help
Entry
CTEST_01975       CDS       T03956                                 

Gene name
tuf
Definition
(GenBank) translation elongation factor 1A (EF-1A/EF-Tu)
  KO
K02358  elongation factor Tu
Organism
cted  Corynebacterium testudinoris
Brite
KEGG Orthology (KO) [BR:cted00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cted03012]
    CTEST_01975 (tuf)
   03029 Mitochondrial biogenesis [BR:cted03029]
    CTEST_01975 (tuf)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cted04147]
    CTEST_01975 (tuf)
Translation factors [BR:cted03012]
 Eukaryotic Type
  Elongation factors
   CTEST_01975 (tuf)
 Prokaryotic Type
   CTEST_01975 (tuf)
Mitochondrial biogenesis [BR:cted03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CTEST_01975 (tuf)
Exosome [BR:cted04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CTEST_01975 (tuf)
  Exosomal proteins of breast cancer cells
   CTEST_01975 (tuf)
  Exosomal proteins of colorectal cancer cells
   CTEST_01975 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: AKK07850
UniProt: A0A0G3H542
LinkDB All DBs
Position
404704..405897
Genome map
AA seq 397 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLADAYPDLNEAFAFDAIDKAPEEKE
RGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDSPDVDEDMIELVEMEVRELLAEQDYDEDAPIIQISALKA
LEGDEKWTKQILELMQAVDDSIPDPVRETDKPFLMPIEDIFTITGRGTVVTGRVERGSLR
VNEDVEIIGIKEKSTTTTVTGIEMFRKLLDYTEAGDNCGLLLRGIKREDVERGQVIIKPG
AYTPHTEFEGSVYVLSKDEGGRHTPFFDNYRPQFYFRTTDVTGVVKLPEGTEMVMPGDNV
DMTVTLIQPVAMDEGLRFAIREGSRTVGAGRVTKIIK
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaggcgaaattcgagcgtacgaagccccacgtcaacatcggcaccattggtcac
gttgaccacggcaagaccaccaccaccgccgccatcaccaaggttctggctgacgcatac
ccggacctcaacgaggccttcgccttcgacgctattgataaggcaccggaggagaaggag
cgtggcatcacgatcaacatctcccacgttgagtaccagaccgagaagcgccactacgcg
cacgtcgatgctccgggccacgccgactacatcaagaacatgatcaccggcgctgctcag
atggacggcgctatcctcgtcgtcgccgcaaccgacggcccgatgccgcagacccgcgag
cacgtgctgctggctcgccaggttggcgttccttacatcctcgttgccctgaacaagtgc
gactctcctgacgttgacgaagacatgattgaactcgtcgagatggaggtccgcgagctt
ctggctgagcaggattacgatgaggacgcccccatcatccagatctccgctctgaaggct
ctggaaggcgacgagaagtggaccaagcagatcctggagctcatgcaggctgtggacgat
tccatcccggatccggtccgcgagaccgacaagccgttcctgatgccgatcgaggacatc
ttcaccatcaccggccgcggcaccgtcgtgaccggccgtgttgagcgtggctccctgcgc
gtcaacgaggatgtcgagatcatcggcatcaaggagaagtccaccaccaccaccgtcacc
ggtatcgagatgttccgtaagctcctcgactacaccgaggctggcgacaactgtggtctg
ctgcttcgtggcatcaagcgcgaggacgttgagcgtggccaggtcatcatcaagccgggc
gcttacaccccccacaccgagttcgagggttccgtctacgtcctgtccaaggacgagggc
ggccgccacaccccgttcttcgataactaccgcccgcagttctacttccgcaccaccgac
gtcaccggcgtcgtgaagctgccggagggcaccgagatggttatgcccggcgacaacgtc
gacatgaccgtcaccctgatccagccggtcgctatggacgagggcctgcgcttcgctatc
cgcgagggctcccgcaccgtcggcgctggccgcgtcaccaagatcatcaagtaa

DBGET integrated database retrieval system