KEGG   Corynebacterium testudinoris: CTEST_02655Help
Entry
CTEST_02655       CDS       T03956                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent, monomeric type
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cted  Corynebacterium testudinoris
Pathway
cted00020  Citrate cycle (TCA cycle)
cted00480  Glutathione metabolism
cted01100  Metabolic pathways
cted01110  Biosynthesis of secondary metabolites
cted01120  Microbial metabolism in diverse environments
cted01130  Biosynthesis of antibiotics
cted01200  Carbon metabolism
cted01210  2-Oxocarboxylic acid metabolism
cted01230  Biosynthesis of amino acids
Module
cted_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cted00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CTEST_02655 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CTEST_02655 (icd)
Enzymes [BR:cted01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CTEST_02655 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH Big_3_2 Cadherin_pro CAMP_factor
Motif
Other DBs
NCBI-ProteinID: AKK07986
UniProt: A0A0G3H3K0
LinkDB All DBs
Position
complement(531682..533895)
Genome map
AA seq 737 aa AA seqDB search
MAKIIWTRTDEAPLLATYSFKPVVEAFVGTAGVEVETRDISLAGRIIAQFPDRLTDEQRI
DDALVELGELAKTPEANIIKLPNISASVPQLKAAIAELQAQGYDLPDYPDNPSTDEDKDV
RKRYDAVKGSAVNPVLREGNSDRRAPEAVKNFVKKHPHRMGAWSADSKTNVATMDADDFR
HNEKSVIMPAADTLTFQLVDAAGNTTKLREDLDVLAGEVVDGTVMRAASLQQFLNEQVAR
AKEEGVLFSVHLKATMMKVSDPIIFGYVVRTFFADVFNKYGDELLAAGLDGENGLGAIYS
GLDSLDNGAEIRAAFDAALAAGPELAMVNSHKGITNLHVPSDVIVDASMPAMIRTSGHMW
NKDDQEQDTLAVIPDSSYAGVYQAVIEDCKANGAFDPTTMGTVPNVGLMAQKAEEYGSHD
KTFKIETDGTVQVLNAAGDVLIEHEVSAGDIWRACQTKDAPIQDWVKLAVDRARISGMPA
IFWLDPARAHDRNLISLVEKYLGDHDTEGLDIQILSPEEATKVSIERIRRGEDTISVTGN
VLRDYNTDLFPILELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQVQEENHLRWDSL
GEFLALAESLRHVARTEDNDQAAILADALDKATEKLLNEGKSPSRKVGEIDNRGSHFYLA
SYWAEELAAQTEDAALAEAFGPIATALNADAAVIDQELIDNQGQPVDLGGYYQPNDEKTS
DVMRPSSKFNEIIDGLK
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagatcatctggacccgtaccgacgaggcaccgctgctggcgacctactcgttc
aagccggtcgtggaggccttcgttggcaccgccggtgttgaggtggaaacccgtgacatt
tccctggccggtcgcattatcgcccagttccccgatcgcctgaccgatgagcagcgaatc
gatgacgctttggtggagctgggcgagctggctaagactccggaagccaacattatcaag
ctcccgaacatctccgcttccgtcccgcagctcaaggccgcgatcgccgagctgcaggcc
cagggctatgatctgccggattacccggacaacccgtccacggatgaggacaaggatgtc
cgcaagcgctacgacgccgtcaagggctcggccgtcaaccccgtcctgcgtgagggcaac
tctgaccgccgcgcgccggaggcagtgaagaacttcgtcaagaagcacccgcaccgcatg
ggcgcctggtccgctgactccaagaccaacgtcgccaccatggatgccgatgacttccgc
cacaacgagaagtccgtcatcatgccggccgcagacaccctgacgttccagctggtcgac
gccgccgggaacaccaccaagctccgcgaggacctcgacgtcctcgccggtgaagttgtt
gacggcaccgtcatgcgcgccgcatcgctgcagcagttcctcaacgagcaggtcgcccgc
gccaaggaagaaggcgtgctcttctccgtgcacctcaaggccacgatgatgaaggtctcc
gacccgatcatcttcggctacgtcgttcgcaccttcttcgccgacgtctttaacaagtac
ggcgatgagctcctcgccgccggcctcgacggcgaaaacggcctcggcgccatctactcc
ggcctggacagcctggacaacggcgcggagatccgcgccgccttcgacgccgctctggcc
gccggtcccgagctggccatggtcaactcccacaagggcatcaccaacctgcacgtcccc
tccgatgtcatcgtcgacgcctccatgccggccatgatccgcacctccggccacatgtgg
aacaaggacgaccaggagcaggacaccctcgccgtcatccccgattcctcctacgccggc
gtctaccaggctgtcatcgaggactgcaaggccaacggcgccttcgacccgaccaccatg
ggcaccgtccccaacgtcggcctcatggcacagaaggccgaggagtacggctcccacgac
aagaccttcaagatcgagaccgacggcaccgtccaggtcctcaacgctgccggtgacgtc
ctcatcgagcacgaggtttctgccggtgacatctggcgcgcctgccagaccaaggacgcc
ccgatccaggactgggtcaagctcgccgtcgaccgcgcccgcatctccggtatgcccgcc
atcttctggctggaccccgcccgcgcgcacgaccgcaacctcatctctctcgtggagaag
tacctgggcgaccacgataccgagggcctggacatccagatcctctccccagaggaggcc
accaaggtctccatcgagcgcatccgccgcggcgaggacaccatctccgtgaccggcaac
gtgctgcgcgattacaacaccgacctcttccccatcctcgagctgggtacgtccgccaag
atgctctccgtcgtgccgctcatggccggtggtggcctcttcgagaccggcgccggtggc
tccgccccgaagcacgtccagcaggtgcaggaagaaaaccacctgcgctgggattccctc
ggcgagttcctcgccctggctgagtccctgcgccacgtcgcccgcaccgaggacaacgat
caggccgccatcctggccgacgccctggacaaggccacggagaagctcctcaacgagggc
aagtccccgtcccgcaaggtcggcgagattgacaaccgcggttcccacttctacctggcc
tcttactgggccgaggaactggccgcgcagaccgaggacgccgcactcgcggaggccttc
ggcccgatcgctaccgcccttaacgccgacgctgctgtcatcgaccaggaactgatcgac
aaccagggtcagcccgttgacctgggtggctactaccagcccaacgatgagaagacgagc
gatgtcatgcgtccgtcctcgaagttcaacgagatcattgacggcttgaagtag

DBGET integrated database retrieval system