KEGG   Yamadazyma tenuis: CANTEDRAFT_102671Help
Entry
CANTEDRAFT_102671 CDS       T03099                                 

Definition
(RefSeq) succinate dehydrogenase
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cten  Yamadazyma tenuis
Pathway
cten00020  Citrate cycle (TCA cycle)
cten00190  Oxidative phosphorylation
cten01100  Metabolic pathways
cten01110  Biosynthesis of secondary metabolites
cten01130  Biosynthesis of antibiotics
cten01200  Carbon metabolism
Module
cten_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cten_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cten_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cten00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CANTEDRAFT_102671
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CANTEDRAFT_102671
Enzymes [BR:cten01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CANTEDRAFT_102671
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 DAO HI0933_like FKBP_N_2
Motif
Other DBs
NCBI-GeneID: 18245569
NCBI-ProteinID: XP_006684947
JGI: Cante1_102671
UniProt: G3AZW9
LinkDB All DBs
Position
Unknown
AA seq 641 aa AA seqDB search
MLSLRNVLGRPSSSTVRMFSQSAVASQTIGSNIKGTDFNAAKYMGQKYHVIDHEYDCVVV
GAGGAGLRAAFGLAEAGFKTACISKLFPTRSHTVAAQGGINAALGNMHKDDWHWHMYDTV
KGSDWLGDQDAIHYMTKEAPQSIYELENYGVPFSRNEEGRIYQRAFGGQAKEYGKGGQAY
RTCAVADRTGHALLHSLYGQSLRHDTHFFIEFFATDLLMQDGECVGVMAYNQEDGTLHRF
RAHKTVMATGGYGRAYFSCTSAHTCTGDGYAMVSRAGLPLEDLEFVQFHPSGIYGSGCLI
TEGARGEGGFLVNSEGERFMERYAPSAKDLASRDVVSRAITMEINEGRGVGAHKDHMYLQ
LSHIPASVLKERLPGISETAHIFAGVDVTKEPIPILPTVHYNMGGIPTKWTGEALRKNEK
GEDEVVPGLFACGEVACASVHGANRLGANSLLDLVVFGRAVAHTITDQLTPGTPLKPAPK
DIGMFSIENLDKMRNANGTKSTAEIRLDMQKTMQKGCAVFRMQDTLDTCVEHIKEVDKSF
AQVKTSDRSMIWNSDLVETLELQNLLTCATQTAHSAAARKESRGAHARDDYQSRDDENWR
KHTLSYQTNWGDEVKLDYRDVIRTTLDENDCKPVPPAVRVY
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgttgagtttacgtaacgttcttggtagaccatcatcatctactgttagaatgttttcc
caatcggccgtggcttctcaaaccattggatccaacattaaggggaccgatttcaatgct
gccaaatacatgggtcaaaaataccatgttatagatcacgaatatgattgtgtggttgtc
ggcgctggaggtgctgggttgagagctgcctttggattggccgaggctggtttcaagacc
gcctgtatctccaagttattcccaaccagatcccatacggtggctgcccaaggaggtatc
aacgcggccttgggaaatatgcacaaggatgactggcactggcatatgtatgacactgtc
aagggttccgattggttgggagaccaggatgccatccattacatgaccaaagaagctcct
caatcgatctatgaattggaaaactatggggttccattctccagaaatgaagagggaaga
atctaccaaagagctttcggaggtcaagccaaagaatacggaaagggtggtcaggcctac
agaacttgtgcggtggctgacagaactggccatgccttgttacactcgttatacggtcaa
tccttaagacacgatacccatttttttattgagtttttcgctaccgacttgttgatgcaa
gacggtgaatgtgtgggtgttatggcttacaaccaggaagatggaactttacaccggttc
cgtgcccacaagactgtcatggccaccgggggttacggaagagcctacttctcctgtacc
tctgcccacacctgtactggtgatggatatgccatggtttcaagagccgggttgcccttg
gaggacttggagtttgtgcaattccatccttccggtatctacggatctggttgtttgatc
acagaaggtgccagaggtgaaggtggattcttggtcaactctgagggtgaaagattcatg
gaacgttatgctccttccgccaaggatttggcttcaagagacgtggtttccagagctatc
accatggaaatcaatgaaggtagaggtgtgggggcacataaggatcacatgtatttacaa
ttgagtcacattcctgcttcggttttgaaggaaagattacctggtatctctgaaactgcc
cacattttcgctggggtcgatgtcaccaaagagcccattcctattttgccaaccgtccac
tacaacatgggaggtattccaaccaaatggactggggaagcattgagaaagaatgaaaag
ggtgaggatgaggttgttcctggattgtttgcctgtggagaagttgcctgtgcttctgtt
cacggtgccaacagattgggagccaactccttattggacttggtggtgtttggaagagcc
gtcgctcacaccatcaccgatcaattgactcctggtactcctttgaagccagcaccaaaa
gacattggtatgttctcgatcgagaacttggacaagatgagaaacgccaacggtactaag
agcaccgctgaaatcagattggatatgcaaaaaaccatgcaaaagggatgtgctgtgttc
agaatgcaagacactttggacacttgtgtggaacacataaaagaagtcgacaagtcgttt
gcccaagttaagacctctgacagatcgatgatttggaactcagatcttgtagaaaccttg
gaattgcaaaacttgttgacctgtgccacccaaaccgctcattcggctgctgccagaaag
gaatctagaggtgcacacgccagagatgactatcaaagcagagacgatgaaaactggaga
aagcacacgttatcataccaaaccaactggggtgacgaagtcaaattggactacagagat
gttatcagaaccaccttggacgagaacgactgtaagccggttccccctgctgtgcgtgtt
tactaa

DBGET integrated database retrieval system