KEGG   Candida tenuis: CANTEDRAFT_103809Help
Entry
CANTEDRAFT_103809 CDS       T03099                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase, E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
cten  Candida tenuis
Pathway
cten00020  Citrate cycle (TCA cycle)
cten00310  Lysine degradation
cten00380  Tryptophan metabolism
cten01100  Metabolic pathways
cten01110  Biosynthesis of secondary metabolites
cten01130  Biosynthesis of antibiotics
cten01200  Carbon metabolism
Module
cten_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cten_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cten00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CANTEDRAFT_103809
  09105 Amino acid metabolism
   00310 Lysine degradation
    CANTEDRAFT_103809
   00380 Tryptophan metabolism
    CANTEDRAFT_103809
Enzymes [BR:cten01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     CANTEDRAFT_103809
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 18245655
NCBI-ProteinID: XP_006685417
JGI: Cante1_103809
UniProt: G3B277
LinkDB All DBs
Position
Unknown
AA seq 1009 aa AA seqDB search
MLRALKTSVPRAHALKSQLLSQRPLLSVSLQVASRRSLATSTDGFLSTTSGNYIDEMYDA
WKQDPTSVHVSWNAYFKNIENNNVPPSQAFSAPPTIIPTVSGGAAGFVPGNEHMSEDVVT
HLKVQLLVRAYQVRGHQKAKIDPLGISFGDSDSAIPRELTLDYYGFTEADLNKQITLGPG
ILPRFAQGKKSMALKDIISTCESLYCSSYGVEYIHIPSKEQCDWLRERIEIPKPFTFSPD
QKRQILDRLIWSCSFESFLATKFPSDKRFGLEGAESVVPGLKAMIDTAVDFGVEDIIIGM
PHRGRLNMLSNVVRKPNESIFSEFTGSKEFDEGSGDVKYHLGMNYARPTTSGKHVNLSIV
ANPSHLEAEDGVVLGKTRAIQHYKNDIGDFKKAMSVLLHGDAAFAAQGVVYETMGFANLP
AYSTGGTIHIIVNNQIGFTTDPRFARSTLYPSDIAKSINAPIFHVNSDDVESLVFVFNLA
AEWRSTFHSDVIIDVVGYRKYGHNETDQPAFTQPLMYKKIAEKKSVLEEYTAQLLAEKTF
TQEDIDEHKKWVWNLLEESFAKSKEYKPTSREWLTTPWEDFKSPKELATEVLPHLPTAVD
EAILKDIGTKISEAPKGFEIHRNLKRILNTRKKSVDTGEGIDWATGEALAFGSLALEGYH
VRVSGQDVERGTFSQRHAVLHDQTSEQTHTPLNNLSEDQGAFAISNSSLSEYGVMGFEYG
YSLTSPDALVVWEGQFGDFANTAQVIIDQFIAAAESKWKQRSGIVLSLPHGYDGQGPEHS
SGRIERYLQLCNEDPRYFPSPEKLERQHQDCNMQIAYPTTPSNIFHLLRRQMHRQFRKPL
ILFFSKSLLRHPLARSELKEFTDDSHFQWIIEDVELGKSIGNKEDIKRIVLCTGQVYTAL
HKKRIALEDTTTAFIKVEQLHPFPFQQLRDALDSYPNVEDLVWCQEEPLNMGPFAYVQPR
LLTTLAETENHKSLTLRYAGRDPSASVAAGSKAMHTQEEEAFLNETFQV
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
atgcttagggctttaaagacatctgtgcctcgtgcccatgccttgaaatctcaactcctt
tcccaaagaccccttttatcggtttcgctccaagtggcctctagacggtcattagctacc
agcactgatggatttttatcaaccaccagtggtaactacatcgatgaaatgtacgatgcc
tggaagcaggatcctacgtccgtgcacgtgagttggaacgcttattttaaaaacattgaa
aacaataatgttcctccttcccaagcattttcagctcccccaacaatcattccaactgtt
tctggtggtgctgctggatttgtccccggaaacgaacacatgtctgaggatgtggtgact
cacttgaaggtgcagttattggtgcgggcgtaccaagtgagaggtcatcaaaaggcaaaa
attgatccattgggaatctcgtttggtgatagcgacagcgctattccaagagaattgacc
ttggattactacgggtttaccgaggcagatttgaataaacagatcactttgggacccggt
atcttgccaagatttgcccaaggtaagaaatcaatggctttgaaagatatcatcagtacc
tgtgaatcattatactgttcgagttacggggtagaatatattcacattccttccaaagaa
caatgtgattggttgagagaaagaattgaaatccccaaacctttcacgttttctccagac
caaaagagacaaattcttgacagattgatctggtcttgctcttttgaatcatttttagca
accaaattcccatccgacaagagattcggtttagaaggtgccgaatcggtggtgccaggt
ttgaaggccatgattgacactgcggtggactttggggttgaagatatcattattggtatg
ccccacagaggtagattaaacatgttgtccaacgtggtgagaaagcccaatgagtctatt
ttcagtgaattcacaggatccaaggaatttgacgaaggttccggtgacgtcaaataccac
ttgggtatgaactacgctagaccaaccacttctggtaaacacgtcaacttgtctattgtt
gctaacccatcccatttggaagctgaagatggggttgttttgggtaagaccagagccatc
cagcactacaagaatgatattggtgacttcaaaaaggccatgtctgtgttgttgcacggt
gacgctgcttttgctgcccaaggtgtggtgtacgaaaccatggggtttgctaacttacct
gcctactctactggtggtactatccacattattgtcaacaatcaaatcggtttcaccact
gacccaagatttgccagatccaccttatacccatctgacattgccaagtctatcaacgcc
cctattttccatgtcaattctgatgacgttgagagtttggtgtttgtgttcaacttagct
gctgaatggagatcaactttccactccgatgttataattgatgtggttggataccgtaag
tacggacacaatgaaactgatcaaccagctttcactcaacctttgatgtataagaagatt
gctgaaaagaagtctgtcttggaagaatacactgctcaattattggcagaaaagaccttc
actcaggaggacatcgacgaacacaagaaatgggtttggaacttattggaagaatctttc
gccaagtctaaggaatacaaaccaacttctagagaatggttaactactccatgggaagac
ttcaagtctccaaaagaattggctactgaagtgttaccccacttgccaactgctgttgat
gaagccatcttgaaggatatcggtactaagattagtgaagctccaaaaggtttcgaaatc
caccgtaatttgaagagaattttgaacactagaaagaagtctgttgataccggtgaaggt
attgactgggctaccggtgaagctttggcttttggttctttggctttggaaggttaccat
gtgagagtttctggtcaggatgttgaaagaggtaccttttctcaacgtcatgctgttttg
cacgatcaaacctccgaacaaacccacactccattgaacaacttgtctgaagatcaaggt
gcctttgctatctccaactcttctttatctgaatatggtgttatgggtttcgaatatggt
tactctttgacttccccagatgctttggtagtgtgggaaggtcaatttggtgatttcgcc
aacactgcccaagttattattgatcaatttatcgctgctgctgaatctaaatggaagcaa
agatccggtattgttttgtccttaccccacggttacgatggtcaaggtccagaacactct
tctggtagaattgaaagatacttgcaattgtgtaatgaagatccaagatacttcccatct
ccagaaaagttggaacgtcaacaccaagactgtaacatgcaaattgcttacccaactacc
ccatccaacatattccacttgttgagacgtcaaatgcacagacaattcagaaaaccattg
attttgtttttctccaagtctttgttgagacatccattagccagaagtgaattaaaggaa
ttcaccgacgattcccactttcaatggattattgaagatgttgaattaggaaagtctatt
ggtaacaaggaagacatcaagagaattgtgttatgtactggtcaagtttacactgcgtta
cataagaagcgtatcgccttggaagacacgaccactgcattcatcaaggttgaacaatta
cacccattccccttccaacaattacgtgatgcccttgacagttatccaaatgttgaagac
ttggtgtggtgtcaagaagaacctttgaacatgggtccatttgcctatgtccaaccaaga
ctcttgacgaccttggctgaaaccgaaaaccataagtctttgactttgcgttatgccggt
agagatccaagtgctagtgttgctgctggttctaaggccatgcatacgcaagaagaagaa
gcgttcttgaacgagactttccaagtctga

DBGET integrated database retrieval system