KEGG   Yamadazyma tenuis: CANTEDRAFT_112485Help
Entry
CANTEDRAFT_112485 CDS       T03099                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
cten  Yamadazyma tenuis
Pathway
cten00010  Glycolysis / Gluconeogenesis
cten00051  Fructose and mannose metabolism
cten00052  Galactose metabolism
cten00500  Starch and sucrose metabolism
cten00520  Amino sugar and nucleotide sugar metabolism
cten01100  Metabolic pathways
cten01110  Biosynthesis of secondary metabolites
cten01130  Biosynthesis of antibiotics
cten01200  Carbon metabolism
Module
cten_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cten_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cten00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CANTEDRAFT_112485
   00051 Fructose and mannose metabolism
    CANTEDRAFT_112485
   00052 Galactose metabolism
    CANTEDRAFT_112485
   00500 Starch and sucrose metabolism
    CANTEDRAFT_112485
   00520 Amino sugar and nucleotide sugar metabolism
    CANTEDRAFT_112485
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CANTEDRAFT_112485
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cten04131]
    CANTEDRAFT_112485
Enzymes [BR:cten01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     CANTEDRAFT_112485
Membrane trafficking [BR:cten04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    CANTEDRAFT_112485
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 18246540
NCBI-ProteinID: XP_006684677
JGI: Cante1_112485
UniProt: G3AZL5
LinkDB All DBs
Position
Unknown
AA seq 481 aa AA seqDB search
MVHLGPKRPQHRKGTFTDVPEQWMEQLHEIENLLTVSAETLRTITTHFVSELEKGLSKAG
GNIPMIPAWVMDTPTGKETGDYLAIDLGGTNLRVVLVRLAGDCTFDTTQSKFALPESFRT
GSADQLFDFIADSLAKFVEEQYPEGCSEPLPLGFTFSYPCSQSKINSGILQRWTKGFDID
NVEGHDVVPMLQASIKKVGVPIDVVALINDTTGTLVASMYTDPEAKMGLIFGTGCNGAYY
DVVGDIPKLEGKFPSDIPATSLMAINCEYGAFDNEHAVLPRTKYDVQIDAESPRPGQQSF
EKMISGYYLGEVLRLVLLDLAEEKGLFFKGQDLSKLHKPFIMDTSFPAHIEDDPFENLSD
VQELFDTVLGIQVTLPERKVIRRLAELIGERSARLSVCGIAAICKKRNYKKAHCAADGSV
YNKYPQFKERAAKALRDIFEWTEDEDPVVIIPAEDGSGVGAAVIAALTEKRLANGLSVGL
E
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggttcacttaggccctaaaagacctcaacacagaaaaggtaccttcaccgatgtccct
gaacagtggatggaacagttgcacgaaatcgaaaacttgttaacggtttcagcagaaacc
ttgagaaccatcaccacccactttgtcagtgagttggaaaaaggcttgagcaaagctggc
ggtaacattcccatgatccctgcctgggtcatggacacccctaccggcaaggagacgggt
gactacttggcgattgatttgggtggaacaaacttgagagtggtgctcgtacggttggca
ggtgactgcactttcgacaccacccagtccaagttcgcgttgcctgaaagctttagaacc
ggctccgccgaccagttgtttgactttatcgccgatagcttggccaagttcgtcgaagaa
caatacccagaaggatgcctggaacctttaccattaggattcactttttcgtacccatgt
tcccaatccaaaatcaactcaggaatcttgcaaagatggaccaagggctttgacatcgac
aacgtggaaggccatgatgtggttcccatgttacaagcatccattaaaaaagtgggtgtt
ccaattgacgtggtggccttaatcaacgataccaccggtacgttggtggcctcgatgtac
acggacccagaggccaagatgggcttgattttcggtactggctgtaacggggcctactac
gacgtggtaggagacatccccaagttggaggggaaattcccatccgacattcctgccacc
tcgttgatggccatcaactgcgagtacggagccttcgacaacgagcacgcagttttgccc
agaacaaagtacgacgtgcaaatcgatgccgaatcacctcgtcccggccagcagtcgttt
gaaaaaatgatttcgggctattatttgggggaggttttgagattggtgttgttggacttg
gccgaagaaaagggcttgttcttcaagggccaggatttatccaagttgcacaagcctttc
atcatggacacgtcgttccctgctcacatcgaagacgacccatttgaaaatttgtcggac
gtccaggagttgtttgacacagttttgggcatccaggtgacgttacctgaaagaaaggtt
attcgtagattggctgaattgattggtgaaaggtccgccaggttgtctgtgtgtggaatt
gctgccatctgcaagaagagaaactacaagaaggcccactgtgcggccgatggatctgtt
tacaacaagtacccgcaattcaaggaaagagctgcaaaggccttgagagacatcttcgaa
tggaccgaggacgaggatccggtggtgattattcctgcagaagatggatcgggcgtaggg
gctgctgtgattgctgccttgactgaaaaaagattggctaacggattatctgttggtctc
gaatag

DBGET integrated database retrieval system