KEGG   Candida tenuis: CANTEDRAFT_113402Help
Entry
CANTEDRAFT_113402 CDS       T03099                                 

Definition
(RefSeq) PLP-dependent transferase
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
cten  Candida tenuis
Pathway
cten00220  Arginine biosynthesis
cten00250  Alanine, aspartate and glutamate metabolism
cten01100  Metabolic pathways
cten01200  Carbon metabolism
cten01210  2-Oxocarboxylic acid metabolism
cten01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cten00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CANTEDRAFT_113402
   00220 Arginine biosynthesis
    CANTEDRAFT_113402
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cten01007]
    CANTEDRAFT_113402
Enzymes [BR:cten01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     CANTEDRAFT_113402
Amino acid related enzymes [BR:cten01007]
 Aminotransferase (transaminase)
  Class I
   CANTEDRAFT_113402
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 18246942
NCBI-ProteinID: XP_006685428
JGI: Cante1_113402
UniProt: G3B292
LinkDB All DBs
Position
Unknown
AA seq 497 aa AA seqDB search
MGARHISFTPAKPLLASELNQSTLDAKYAVRGKIPIRADEIRNHIESNPNSHGLPYDRII
SANIGNPQQLDQKPLTWYRQVLSLLQYPHILDKVDASVIHELFPKDVIERAKTILGSTGS
MGAYSHSQGDSYVRKSVAKFISERDGYPADPQSIFLTGGASAAVQYLLQILSSDKNSGFL
IPIPQYPLYTATIALNNAVPIGYFLDEANNWSTNPTQIRQLIHENNAKGINIKALVVINP
GNPTGAILTKEDIKNIIDIAAEHGLVLIADEVYQENVFEGEFVSMKRVLSELNEQHPELY
SNVQLASLHSTSKGVSGECGQRGGYMELVGFTEEVRQVVFKLASINLCSVVSGQALMELM
VNPPKPGQESYEVYHAETSGIHSDLQGRSSSLYAAFNKMEDITCNKPMGAMYLFPRLNFT
EESYPKLYKDSDDTGVVVDELYCVELLESTGICCVPGSGFGQVPDTYHLRTTFLPPGTEW
IESWANFHKEFVKKYKG
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgggggctaggcacattagctttacgcctgccaaaccgcttctcgctagcgaattgaac
caactgactttggatgcaaagtatgccgtcagaggtaagatccccattcgagcagatgaa
attagaaaccatattgaatccaatccaaatagccacggcttaccctacgatagaatcatc
agcgccaatatcggcaaccctcaacaattagaccaaaaacccttgacctggtaccgccaa
gtattgtcgttattgcagtatcctcatatcttagacaaggtcgacgcttctgtaatccac
gagttattccctaaggacgtgatcgaaagagccaaaactatcttgggttccaccggatct
atgggagcatacagccattctcaaggagatagctacgtgagaaagtcagttgcaaagttt
atttccgaaagagacggatacccagccgaccctcaaagtatttttttgacaggaggtgct
tctgctgctgtacaatacttgttacagattttgtctagtgacaagaactcgggcttcttg
atcccaatacctcagtatcctttgtacactgctaccattgctttgaacaatgctgtgcca
attggatactttttggacgaagccaacaattggtcaacaaatcctactcaaattagacag
ttaatccatgaaaacaatgccaagggaatcaacatcaaggctttagtggtgatcaatccc
ggtaacccaactggtgctattttaaccaaagaggacatcaaaaatatcattgatattgct
gcagaacatggtttggtgttgattgcagatgaggtttaccaggaaaacgtttttgaagga
gagtttgtgtcaatgaagagagtgttgagtgagttgaacgaacaacacccagaattgtac
tccaatgtgcaattggcttctttgcactccacctctaaaggggtgagtggtgaatgtggt
caaagaggtggatatatggagttggttggcttcactgaagaagtcagacaggtggttttc
aaattggcttctattaacttgtgttctgttgtttctggccaggctttgatggagttgatg
gttaaccctcctaagcctggtcaggaatcgtatgaagtatatcatgcggagaccagtggt
atccacagtgacttacaagggagatcttcatcactatacgctgccttcaacaaaatggag
gatatcacttgtaacaaaccaatgggtgccatgtacttgttccctagattgaactttaca
gaggagagctaccctaagttgtacaaagattctgatgacactggtgtggttgtggatgag
ttgtactgtgtcgaattattagaaagcactggaatctgttgtgttccaggttctggtttt
ggtcaagttcctgatacttatcacttgagaacaaccttcttacctccaggtacagagtgg
atcgaaagctgggctaatttccacaaagaatttgtcaaaaagtataagggttag

DBGET integrated database retrieval system