KEGG   Candida tenuis: CANTEDRAFT_114184Help
Entry
CANTEDRAFT_114184 CDS       T03099                                 

Definition
(RefSeq) hypothetical protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cten  Candida tenuis
Pathway
cten00020  Citrate cycle (TCA cycle)
cten00480  Glutathione metabolism
cten01100  Metabolic pathways
cten01110  Biosynthesis of secondary metabolites
cten01130  Biosynthesis of antibiotics
cten01200  Carbon metabolism
cten01210  2-Oxocarboxylic acid metabolism
cten01230  Biosynthesis of amino acids
cten04146  Peroxisome
Module
cten_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cten_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cten00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CANTEDRAFT_114184
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CANTEDRAFT_114184
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CANTEDRAFT_114184
Enzymes [BR:cten01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CANTEDRAFT_114184
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 18247306
NCBI-ProteinID: XP_006686701
JGI: Cante1_114184
UniProt: G3B3F4
LinkDB All DBs
Position
Unknown
AA seq 423 aa AA seqDB search
MFRTSSIRGFSSSARALKIKVSTPVVEMDGDEMTRIIWQRIKDKLIHPYLDIDLKYYDLG
IEARDKTNDQITIDAANAIKKYGVGIKCATITPDEARVKEFNLKKMWVSPNGTIRNILNG
TVFRESIIIPNIPRLVPGWEKPIVIGRHAHGDQYKATDLVISEPGKLEMVFTPQNGGEKV
VKEVYTYPETGGVGLAMYNTDESIRGFAHSSFKMALNKNLPLYLSTKNTILKKYDGRFKD
IFQEVYEAEYQTEFEAKGLWYEHRLIDDMVAQMIKSKGGYVMALKNYDGDVQSDIVAQGF
GSLGLMTSVLITPDGKAFESEAAHGTVTRHYRQHQQGKETSTNSIASIFAWTRGLIQRGK
LDNTPELVEFAQKLEDVTVQTVIDGTMTKDLALAQGKTDRSSYVTTTEFLDAVAEKLQQS
VSV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaaccagcagtattagaggattcagctccagtgccagggcattgaagattaag
gtttccacccccgttgtggaaatggatggtgacgaaatgaccagaattatctggcaaaga
atcaaagacaagttgatccacccatacttggacatcgatttgaagtactacgatttggga
attgaagccagagacaagaccaacgatcaaatcaccatcgacgccgctaacgccatcaag
aaatacggtgtgggtatcaagtgtgccacgatcacgccagacgaggctagagtcaaagaa
ttcaatcttaagaaaatgtgggtttctccgaacggaactatcagaaacattttgaacgga
actgttttcagagagagtattatcatccccaacatccccagattggtgccaggttgggaa
aagcctattgtgattggtagacacgcccacggtgaccaatacaaggccactgatttggtg
atcagtgaacctggaaagttggagatggttttcactcctcagaatggaggtgaaaaagtc
gtgaaggaagtgtacacataccccgaaaccgggggtgtgggcttggctatgtacaacacc
gacgagtccatcagagggttcgcccattcgtctttcaagatggctttgaacaagaacttg
ccattgtacctttccaccaaaaacaccattttgaagaagtacgacggaaggttcaaggat
attttccaggaagtgtatgaagccgagtaccagactgaatttgaagccaaaggattgtgg
tatgaacacagattaatcgatgatatggtcgcacagatgatcaagtctaagggaggatat
gtgatggctttgaaaaactacgatggggatgtgcaatcggacatcgttgcccaagggttc
gggtcgttgggtttgatgacttcggtattgattactccagacggcaaggcttttgaaagt
gaagctgctcacggaaccgtaaccagacactacagacaacatcaacaaggtaaagaaact
tcaaccaactcgattgcgtcgatttttgcctggacaagagggttgattcaaagaggaaag
ttggacaacacccctgaattagtagagtttgcccaaaagttggaagacgttacggtgcaa
acagtcatcgacggtaccatgaccaaagatttggcgttggcccaaggcaaaaccgacaga
ctgtcatatgtaacgaccacggaatttcttgacgccgttgccgagaagttacagcaatct
gtttccgtctaa

DBGET integrated database retrieval system