KEGG   Yamadazyma tenuis: CANTEDRAFT_114306Help
Entry
CANTEDRAFT_114306 CDS       T03099                                 

Definition
(RefSeq) GNS1/SUR4 membrane protein
  KO
K10246  fatty acid elongase 3 [EC:2.3.1.199]
Organism
cten  Yamadazyma tenuis
Pathway
cten00062  Fatty acid elongation
cten01040  Biosynthesis of unsaturated fatty acids
cten01100  Metabolic pathways
cten01110  Biosynthesis of secondary metabolites
cten01212  Fatty acid metabolism
Module
cten_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cten00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    CANTEDRAFT_114306
   01040 Biosynthesis of unsaturated fatty acids
    CANTEDRAFT_114306
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cten01004]
    CANTEDRAFT_114306
Enzymes [BR:cten01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     CANTEDRAFT_114306
Lipid biosynthesis proteins [BR:cten01004]
 Elongase
  LCFA
   CANTEDRAFT_114306
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ELO
Motif
Other DBs
NCBI-GeneID: 18247365
NCBI-ProteinID: XP_006686784
JGI: Cante1_114306
UniProt: G3B6Q7
LinkDB All DBs
Position
Unknown
AA seq 334 aa AA seqDB search
MNFEVSYPSVERPFGVHLWPIFDYAFERVVGYPATQFEFLHNQTFLANGYHAVGVIIVYY
LVIFGGRFVMTTLDVPALKLNLLFQLHNLVLTAGSGILLLLSIEQVLPIIVKDGIFGAIC
YETAFTQKLVTLYYLNYLTKYLELVDTVFLVLKRKKLLFLHVYHHGATALLCYTQLVGYT
AVEWVPITLNLTVHVVMYWYYFLSARGIRVWWKEWVTRIQIVQFVIDLVFIYFATYTHFA
FAYFPNVPQYGKDCYGSEVAAVYGVLIITSYLLLFISFYFSVYRGKSKKVATAIATASAT
NDVKPTATTSGSTTGSTTGSTAKKHVTKSKSRKA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcgaagtctcgtatccatcagtcgaaagaccatttggcgtccacttatggccc
atttttgactacgcattcgaacgcgtggtgggctatcccgccactcagtttgagtttctc
cacaaccagacattcttggccaacggctaccatgcggtgggtgtcatcattgtctactac
cttgtcatttttggcggacgctttgtcatgaccaccctcgacgtgccggcgcttaagttg
aacttgttgttccagttgcacaacctcgtattgacggcggggtcagggattttgttattg
ttgtcgattgaacaagttttgcccatcatcgtgaaggatgggatttttggggcgatctgc
tacgaaaccgcgtttacccagaagttggtaactctctactacttgaattacctcaccaag
tacttagagcttgtggatacggtatttttggtgttgaagcgcaaaaagttgttgtttttg
cacgtctaccaccacggcgccaccgcgctcttgtgctacacccagttggtagggtacacg
gcggtagaatgggtgcctattactttgaatctcacggtgcacgtggtgatgtactggtac
tatttcctctctgctcggggcattcgtgtgtggtggaaggaatgggtaacccggatccag
attgtgcagtttgtcattgacttggtatttatctattttgccacctacacccactttgca
tttgcgtacttccccaacgtgccacaatatggtaaggactgttacgggtcggaagttgct
gctgtctacggggtgttgatcattaccagctacttgcttttgtttatctccttttacttt
agcgtgtaccgcggaaagtcgaagaaggttgccactgccattgccactgccagtgctacc
aatgacgttaagcccactgccactaccagtggcagtaccactggtagtaccactggtagt
actgccaagaagcatgtcaccaagctgaagtccaggaaggcttaa

DBGET integrated database retrieval system