KEGG   Yamadazyma tenuis: CANTEDRAFT_115247Help
Entry
CANTEDRAFT_115247 CDS       T03099                                 

Definition
(RefSeq) DNA repair protein rad10
  KO
K10849  DNA excision repair protein ERCC-1
Organism
cten  Yamadazyma tenuis
Pathway
cten03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:cten00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    CANTEDRAFT_115247
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cten03400]
    CANTEDRAFT_115247
DNA repair and recombination proteins [BR:cten03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     CANTEDRAFT_115247
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad10
Motif
Other DBs
NCBI-GeneID: 18247792
NCBI-ProteinID: XP_006687978
JGI: Cante1_115247
UniProt: G3B8Y8
LinkDB All DBs
Position
Unknown
AA seq 325 aa AA seqDB search
MDPTSFASVLEGVKRMREQYADASDDGDDADSAPKRPQTDSPQPDQSLPSSATSASDATN
TRITNTTLPTQPMVRSSLSPSPVGVGQSSRPVSRRIQPAVQMYSQIQVAPSQKGNPVFQS
SLLKQKPIAYNKEILSDYYINPTLQVLFLSMKYHQLHPEYIWRRCKKLNQGSTVSTIKDN
ACKILLAVIDIESPQEALRKLNNICIKQDLTLLIAWSFEQAGNYIAMLKDNELSRTKVNL
TIRGAKQSDFKSNLTDTLTSIRAINKTDVINLMTEIGSFKDIVEADNIKIHGFGDRKISN
LKATFSQPFILNKEQTPDNEPERSQ
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggatccaacctcgtttgcaagtgtgttagagggcgtcaagcgcatgcgagagcagtat
gctgatgccagcgatgatggtgatgatgcggactctgcccccaagcgtcctcaaaccgac
agcccgcaacccgatcaactgctcccttcatctgcaactagtgcaagtgatgccacaaac
acaagaatcacaaatacaaccctccccacacaacccatggttcgatcgctgctactgccg
ctgccggtgggtgtcgggcagagctctcgcccggtctctcgccgcattcagcccgcagtt
caaatgtactcccagattcaagtggccccgtcacagaagggaaacccagtcttccagagc
tccttgcttaaacagaagcctatcgcgtataataaggaaatcttgtctgactactacata
aaccccacgctccaagtgttgtttctttcaatgaagtatcatcaattacaccccgagtat
atatggcgaaggtgtaaaaaactcaaccagggttctacggtgctgaccattaaagacaac
gcgtgtaagattcttttggcagtaatcgacatcgagagtccgcaagaagcgcttcgcaag
ttgaacaatatctgtatcaagcaagacttgacgttacttatagcatggtcttttgagcaa
gccggtaactacatcgccatgttgaaggacaacgagctttcaagaaccaaggtgaacttg
acgatccgaggagccaagcagagcgacttcaagtccaatttgaccgatactctcacgagc
attcgagctattaacaagacagacgtcatcaacctcatgacagaaatcggctcgttcaag
gacattgtggaggctgataacatcaaaatccatggttttggtgacagaaagatcctgaat
ctcaaggccaccttcagccagccattcatcttgaataaggaacaaactccagataatgaa
cctgaacgactgcaataa

DBGET integrated database retrieval system