KEGG   Yamadazyma tenuis: CANTEDRAFT_115498Help
Entry
CANTEDRAFT_115498 CDS       T03099                                 

Definition
(RefSeq) Six-hairpin glycosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
cten  Yamadazyma tenuis
Pathway
cten00500  Starch and sucrose metabolism
cten01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cten00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CANTEDRAFT_115498
Enzymes [BR:cten01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     CANTEDRAFT_115498
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 18247894
NCBI-ProteinID: XP_006688924
JGI: Cante1_115498
UniProt: G3BAE2
LinkDB All DBs
Position
Unknown
AA seq 519 aa AA seqDB search
MKFSLWLLAVSVPLSTALPLGLKQYFFNLLVDIRSSDPFPVDPTFSDNVNKTTLDSWLAD
EYDVAWNNLLRNIGNSSTCLDPNIFPGVIVASPSKVKPDYYYQWTRDSSLTIRTLIHYLQ
DSVNKSDSDPRFQEYQWLVENYIWNNFHLQRLPTMSGDFDSGNTLGEPKYLVNNSQFNQN
WGRPQNDGPGLRISSILSFVSLELPSQTGLNTTFIFNEIIKPDLLFVANNWMKESFDLWE
EIKSLHFFTSSVQLKGLLDGIQFINSNSYLNVDQEVVDTLVTNYKDLKKFIESYYISTKT
NYVLESPALFPHTRSGLDSAVLLGAIHSHDMNENDKLIPFDIDSNHILNHLVKIAGDMKS
RYPINHHLDFSNAVGIGRYPEDVYDGYGTSEGNPWFISTATAAELLYKFAYKLVTAKEDL
IITAANKDFFKLVLQLDDTQDFVVIKYKSAVFNDLIENLLKFSDNFLVVVKDHVDLKGGV
SEQFNKYHGFMEGARDLTWSYSSLLNAFRWRGKVMKLVT
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgaagttttccttatggttattggcagtttcggtgcccttgctgacggctttacccttg
ggattaaaacaatacttttttaacttgttggttgacatcaggtcatcagatccatttcca
gttgatcctacgttctccgacaacgtcaacaaaaccacacttgattcgtggctagctgat
gagtacgacgtggcgtggaacaacttgctccgcaacattggtaactcttccacttgtttg
gaccctaatatctttccgggtgtgattgtggcttcaccatcaaaagtcaaacctgactat
tattaccagtggaccagagacagttctttaacaatccggaccttgatacactatttgcag
gactcggtgaataaatccgactctgaccccaggtttcaagaataccagtggttggtagaa
aattatatctggaacaacttccacttgcagcggttacccacgatgtcaggggacttcgac
tcgggaaacactttgggagagcccaagtacttggtcaacaatagccagttcaaccaaaat
tggggaagacctcagaacgatgggcccggccttagaatctcctcgatattatcgtttgtc
agcttggagttaccttctcagacaggcttaaacaccacgtttatcttcaacgagatcatc
aagcctgatttactctttgtggctaacaactggatgaaagagtcgtttgacttatgggaa
gaaatcaagtccttgcacttttttacgtcactggtacagttgaaaggattgttggatgga
attcagttcattaacctgaactcttatttgaacgttgaccaggaagtggttgatacgttg
gtcaccaactacaaggatttgaaaaagtttattgagtcatactatatcagtaccaagacc
aattatgtgcttgaatctcctgctttgtttcctcataccagatctggtttggactcggca
gtattgttgggggctattcattcccatgacatgaatgaaaacgataagcttatacctttt
gacattgacagcaaccatatcttgaaccatttggtgaagattgctggtgacatgaaatca
agatatcccattaatcaccatttggacttcagcaatgcggttgggatcggtagatatcct
gaagatgtttatgacggttacggtactagtgaaggaaatccatggttcatttcgactgct
actgctgcagaattgctttataagttcgcctacaaattggtgactgctaaagaggacttg
atcatcacggctgcaaataaagatttcttcaaattggtgttgcaacttgacgatacacag
gactttgttgtaatcaagtataagtcggcggtttttaatgacttgattgaaaatcttctc
aaattcagtgacaatttcttagtagtggtgaaagatcatgtggacttgaagggtggtgtc
agcgagcagttcaataagtaccatggtttcatggaaggagccagagacttgacatggagt
tattccagtttattgaatgctttcaggtggagaggtaaggttatgaaactagtgacttag

DBGET integrated database retrieval system