KEGG   Candida tenuis: CANTEDRAFT_115842Help
Entry
CANTEDRAFT_115842 CDS       T03099                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cten  Candida tenuis
Pathway
cten00250  Alanine, aspartate and glutamate metabolism
cten00410  beta-Alanine metabolism
cten00430  Taurine and hypotaurine metabolism
cten00650  Butanoate metabolism
cten01100  Metabolic pathways
cten01110  Biosynthesis of secondary metabolites
Module
cten_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cten00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    CANTEDRAFT_115842
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CANTEDRAFT_115842
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CANTEDRAFT_115842
   00430 Taurine and hypotaurine metabolism
    CANTEDRAFT_115842
Enzymes [BR:cten01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CANTEDRAFT_115842
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 dCache_3
Motif
Other DBs
NCBI-GeneID: 18248048
NCBI-ProteinID: XP_006689053
JGI: Cante1_115842
UniProt: G3B8F0
LinkDB All DBs
Position
Unknown
AA seq 559 aa AA seqDB search
MTLTKNPSSYELTKSIVSKVHKTPLNAREEFTSSYDSNKLFPRFHIPNESSDSHLIFKYV
TEELSLDGNPTLNLASFVNTELSEPARALINDNLVKNLADNDEYPSLIEFQGRCISMISS
LWHAPQHYDEQLRREVPATVGTATTGSSEAIMLAGLALKKSWQERQRQAGKSTENPNILM
ATCAQVALEKFARYFDVENRLIEISAESGHVIDVKKIKENIDENTIGIFVIMGSTFTGAF
EPVLEINNLLDEVEKETGVDVKIHVDGASGGFTAPFTHPNLKWDFSVDRVVSINTSGHKF
GLTTAGLGWVIWKNIKYLPENLRFKLDYLGGIEETFNLNFSRAGFPVIHQYYNFLTLGRE
GYTKLFDNCMNNARVLSLFLEECSYFEVLSVIHKPAIPGSYKLDKIDDTNFHEQYQPGLP
VVAFRFSKDFTKKYPEIPQNILSLLLRNKGFIVPNYHLPPGEQSKEILRVVVKSSLSLNL
LEKLMQDILSSVELLISSCDSVRNLIAAKDKGKLDHKVVYDLLLSVASNGVEELKGHQKK
FHAAKSGHSPHKNSYRGAC
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgacattgaccaaaaaccctagctcttatgagctcaccaaatcaatcgtcagtaaggtc
cacaaaacccccctcaatgcccgagaagagttcacctcctcgtatgactccaataagttg
ttccccaggttccacatccccaacgagtctagcgattcccatttgatattcaagtacgta
acagaggaattgtcgttggacggaaaccccacgttgaacttggcgtcgtttgtcaacaca
gagctttcagaacctgccagagctttgatcaacgacaacttggtgaaaaatttggctgat
aatgacgaatatcccagtttgattgagtttcagggaagatgtatctccatgatcagtagc
ttgtggcatgcaccgcaacactacgatgagcaattgaggagagaggttcctgccactgtg
ggcaccgccactaccggctcgtcggaggccattatgttggcaggtttggccttgaagaag
agctggcaggaaagacagcggcaggcgggcaaaagtaccgaaaaccccaacatcttgatg
gccacgtgtgcgcaggtggcattggagaagtttgcccggtactttgacgtggagaaccgg
ttgattgaaattagtgctgaaagtggccatgtaattgatgtcaagaagatcaaggagaac
attgatgagaacaccatcgggatctttgtgattatgggctcaaccttcacaggggcgttc
gagccggtgttggaaatcaacaacttgttggacgaagttgagaaagaaaccggtgtggac
gttaagatccacgttgatggggccagtggaggctttactgctccattcactcaccccaac
ttgaagtgggattttctggttgatagagttgtatcaatcaacacttcgggccacaagttt
ggtttgaccactgctggtttgggttgggtaatctggaagaacatcaagtatttacctgag
aatttgagatttaagttggactacttgggaggtatcgaggagactttcaatttgaacttc
tctagagccggattccccgtcattcaccagtactacaatttcttgacgttaggtagagaa
gggtacaccaagttgtttgacaattgtatgaacaatgcgcgggtgctctcgttgttcttg
gaagagtgctcttatttcgaggtgttgtctgtgatccacaaacccgctatcccaggaagt
tataagctcgacaagattgatgataccaacttccacgagcagtaccagccaggattacct
gtggttgcgtttagattctccaaggatttcacaaagaagtaccccgagattccacagaat
atcctctctttgttgttaagaaacaagggatttattgtccccaactaccacttaccccct
ggggaacagctgaaggagattttgagagtggtggtcaagtcatcacttagtttgaacttg
ttggagaagcttatgcaagatattctttcgtcggtagagttgttgatttcgtcgtgcgat
tctgtcaggaacttaattgctgcaaaagacaaaggtaagctcgatcacaaagttgtttat
gacttattgttgtcggttgcttctaatggggttgaggaacttaaggggcatcaaaagaag
ttccacgcagccaagtctggtcactcgcctcacaagaactcctacagaggagcttgttaa

DBGET integrated database retrieval system