KEGG   Yamadazyma tenuis: CANTEDRAFT_116309Help
Entry
CANTEDRAFT_116309 CDS       T03099                                 

Definition
(RefSeq) hypothetical protein
  KO
K01240  uridine nucleosidase [EC:3.2.2.3]
Organism
cten  Yamadazyma tenuis
Pathway
cten00240  Pyrimidine metabolism
cten00760  Nicotinate and nicotinamide metabolism
cten01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cten00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CANTEDRAFT_116309
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CANTEDRAFT_116309
Enzymes [BR:cten01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.3  uridine nucleosidase
     CANTEDRAFT_116309
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IU_nuc_hydro DUF296
Motif
Other DBs
NCBI-GeneID: 18248240
NCBI-ProteinID: XP_006690284
JGI: Cante1_116309
UniProt: G3BD63
LinkDB All DBs
Position
Unknown
AA seq 336 aa AA seqDB search
MTRAPIPIWLDCDPGTDDAFAILLLAFHPQFNLIGISTVHGNAPLNATTHNTVGLLDVLK
LNHIPVYAGEVRPLVKEPFFGLYAHGKTGLGGAELPENPSVVVKNDKSYMEAIKEAVETH
ANEICVIATGTFTNMSNLFAKYPDLKHKIKYLPIMGAGFGVGNVTPYAEFNVYVDPKAAN
NLFHDEDLMDKLIVNGLNITHTAIADETIRQKLFGKPHKNLVRPMFESIMMFYFKQLYSE
NGWAGPPLHDPLAVFTLLPVLYGAQAYKFEWFRRRVTAVEGGENDGETVFVDGSKFEDDG
SEEHGSIIAKSVDIDMFYEYVGVALDNAEEHVQKRS
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgactagagctcctatacccatatggctcgactgtgaccccggcacagatgacgcattc
gccattttgctacttgctttccacccgcaattcaacctcatcggcatctccacagtccac
ggaaatgctcctttaaatgctactacgcacaatactgttggtcttctcgacgtgttgaag
ttgaaccacataccagtgtatgccggagaagtacgtcctttggtcaaagagccatttttt
ggcctctatgcccatggaaaaaccgggttgggtggtgctgaactacctgaaaaccccagc
gtagtagttaaaaacgacaagtcgtacatggaggccatcaaggaagcggtggaaacgcat
gccaacgagatctgtgttattgccactgggaccttcacaaacatgtccaacctttttgcc
aagtacccggacttaaagcacaaaatcaagtatcttcctatcatgggggccggcttcgga
gtgggaaacgtcactccttatgccgagttcaacgtgtatgtggatcccaaggccgccaac
aacttgttccacgacgaggatttaatggataaacttattgtcaatgggttgaacattacg
cacactgccatagctgatgagaccattcgtcagaagttgtttggaaaaccccacaagaat
cttgtgagacccatgtttgagagcatcatgatgttctacttcaagcagctctactccgaa
aatggatgggctggtcctccattacacgatcctttggccgtgttcacattattgccggta
ttgtatggagctcaagcctacaagttcgagtggttccgtagaagagtcactgccgttgaa
gggggtgagaacgacggtgagactgtgtttgtggatgggtccaagtttgaggacgatggc
agcgaagagcatggttctatcatcgctaagtctgtcgacatcgatatgttttacgagtat
gtgggggttgcacttgataatgccgaggagcatgttcagaaaagaagctag

DBGET integrated database retrieval system