KEGG   Candida tenuis: CANTEDRAFT_125078Help
Entry
CANTEDRAFT_125078 CDS       T03099                                 

Definition
(RefSeq) hypothetical protein
  KO
K02358  elongation factor Tu
Organism
cten  Candida tenuis
Brite
KEGG Orthology (KO) [BR:cten00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cten03012]
    CANTEDRAFT_125078
   03029 Mitochondrial biogenesis [BR:cten03029]
    CANTEDRAFT_125078
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cten04147]
    CANTEDRAFT_125078
Translation factors [BR:cten03012]
 Eukaryotic Type
  Elongation factors
   CANTEDRAFT_125078
 Prokaryotic Type
   CANTEDRAFT_125078
Mitochondrial biogenesis [BR:cten03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CANTEDRAFT_125078
Exosome [BR:cten04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CANTEDRAFT_125078
  Exosomal proteins of breast cancer cells
   CANTEDRAFT_125078
  Exosomal proteins of colorectal cancer cells
   CANTEDRAFT_125078
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-GeneID: 18249077
NCBI-ProteinID: XP_006688019
JGI: Cante1_125078
UniProt: G3B9A4
LinkDB All DBs
Position
Unknown
AA seq 427 aa AA seqDB search
MLSNFASIARANVRFALRASRPALTRGYALFDRSKPHVNVGTIGHVDHGKTTLTAAITKV
LAQRGGADFLDYANIDRAPEERARGITISTAHVEYSTEKRHYAHVDCPGHSDYIKNMITG
AAQMDGAIIVVAATDGQMPQTREHLLLARQVGIQNLVVFVNKVDTIDDPEMLELVEMEMR
ELLTQFGFDGDNTPVIMGSALCALEGKQPEIGEEAIMKLLDAVDEHIPTPTRDLEQPFLL
PVEDVFSISGRGTVVTGRVERGSLKKGEEIEIVSYLDKPIKATVTGIEMFKKELDAAMAG
DNAGILLRGVKRDDVNRGMILAKPGSVTPHTKILASLYILTAEEGGRHSPFGENYKPQLF
IRTSDVTGTLRFPSGEGVDHSQQVMPGDNIEMEIELVKKTPIEVNQRFNLREGGKTVGTG
LVTRIIE
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcttagcaacttcgcttctattgccagggcaaatgttaggtttgctttgagggccagt
aggccagccctcaccagaggatacgctttgttcgaccgttccaaaccccatgtcaacgtc
ggtaccattggccacgttgatcacggtaagaccactttgaccgccgctatcaccaaggtt
ttggcacaaagaggtggtgccgatttcttggactacgccaacatcgacagagctcccgaa
gaaagagccagaggaatcaccatttccaccgcccacgttgagtattctaccgagaaaagg
cactatgctcatgttgactgtcccggtcacagtgattatatcaagaatatgattactggt
gctgcccagatggatggtgctattattgttgttgctgctaccgacggtcaaatgcctcag
accagagaacatttgttgttggccagacaagttggtattcaaaatttggttgttttcgtt
aacaaggtggacaccattgatgacccagagatgttggaattggttgagatggaaatgaga
gaattattgacccaatttggttttgatggtgataacaccccagtgatcatgggatctgct
ttgtgtgctttggaaggaaaacaacctgaaattggtgaagaagccatcatgaaattattg
gatgctgttgacgaacatattccaactccaaccagagacttggaacaacctttcttattg
ccagttgaagacgtgttttctatctccggtagaggtactgttgtcactggtagagttgaa
agaggttctttgaagaagggtgaagaaattgaaattgtcagttacttggacaagcctatc
aaggcaactgttactggtatcgaaatgttcaaaaaagaattggacgctgccatggctggt
gacaatgctggtatcttgttgagaggtgtcaagagagatgatgttaacagaggtatgatt
ttggccaaaccaggttcggtcactcctcacaccaagatcttggcttccttgtatattttg
actgctgaagaaggtggtcgtcactctccatttggtgagaactacaaacctcaattgttt
atcagaaccagtgatgtgactggtaccttgagattcccaagcggtgaaggtgttgaccac
tctcaacaagttatgccaggtgacaacatcgaaatggaaatcgaattggttaagaagact
cctattgaagttaaccaacgtttcaaccttagagaaggtggtaagaccgttggtaccggt
ttggttactagaatcattgagtaa

DBGET integrated database retrieval system