KEGG   Yamadazyma tenuis: CANTEDRAFT_126474Help
Entry
CANTEDRAFT_126474 CDS       T03099                                 

Definition
(RefSeq) hypothetical protein
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
cten  Yamadazyma tenuis
Brite
KEGG Orthology (KO) [BR:cten00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cten03036]
    CANTEDRAFT_126474
Enzymes [BR:cten01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CANTEDRAFT_126474
Chromosome and associated proteins [BR:cten03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     CANTEDRAFT_126474
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl Rpp20
Motif
Other DBs
NCBI-GeneID: 18249175
NCBI-ProteinID: XP_006688629
JGI: Cante1_126474
UniProt: G3B947
LinkDB All DBs
Position
Unknown
AA seq 701 aa AA seqDB search
MSLKDDLKDNDSEDSLISQFETTLTIRSTANDYEDDVSMAHSTFYNHSGYMRDQTIPIYE
EDEDDDDEVIHPAEIIQFKGKRTNRLKTTSASRSSSNSRSSKSPSPPPIPELIWEETQKY
EKILKPSSLIDTSLSKFTNTFSDFLKSNPQIERDSPKFRKESDRTLVVLSPYSAEHAFGR
KWVTKSYLATIFERPQRLLASCIGIAAALTMYPFFYKIVNSTKRGSIFSSHVLKIHGKNW
PRKLYELCLESHEKLAEGNLEVPEDWNTGDIYLIPKTINAIEGVIGAIETGIDSLFKQNY
NLSFIVIRPPGHHSHACLPSGFCLLNNVQIGIEYAFENYDVSHVAILDIDLHHGDGSQDI
CWERAGFTGDYGKDEDEDLELGFEPRDEYGKRFARYPKVGYFSLHDVKSYPTELGYATKE
NIKNASTCIMDHDLNIWNVHLQEWEDEDEFYKHYKTKYVSILNRVNQFLNQAKKQHELEF
QQYLINKKNGSLNSNSKDKPPMAFKPMIVISAGFDASEYENPQMQRHGINVPTSFYSKFT
NDAVKLSKIHNSKLISFLEGGYSDGALTTGIFSHLIGLTNSVNAHMEGDKVDSNLWNSTW
GSDFVMKELTKGCKKNWMPYKQPKTDVTIWANEAIKLGRSMMPNAVLPNNYIYQYKEEGA
GDIPNRMVKDLIDADTRINEDGGPRHTRSYLKKLALAQQKE
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgtcattgaaagacgacctcaaggataatgacagtgaagactcgcttatctcccagttc
gagactactttgaccatcaggtccactgccaacgactacgaagatgacgtttccatggct
cactccaccttctacaatcactccggttatatgagagatcagacgatccccatctatgag
gaggatgaggatgacgacgacgaggtgatacatccagcagagatcattcagttcaaaggt
aagcgaaccaaccgtctcaaaacaactagcgcttcccggtccagctcaaactctcgctcc
agcaagagccccagtccgccaccgattccagaacttatatgggaagagacccaaaagtac
gagaagatcttgaagccttcgagtttaattgacacatcgttgtcaaagtttacaaacacc
ttcagcgacttcttgaaatccaacccacaaatagagcgtgactcgcccaagtttaggaag
gagagtgacagaacccttgtggtgttatcgccctactcagctgaacacgcatttggcaga
aaatgggtcaccaagtcgtatctagccaccattttcgagcgcccacaacgtttactagca
tcttgcataggcattgcggcggcattgaccatgtacccgttcttctacaagatcgtcaac
tccaccaaaagagggtctattttttcatcgcatgtattgaagattcatggcaaaaactgg
ccccgaaagctatacgaactatgtctagaaagccacgagaagctcgcggagggaaacttg
gaggttccagaagattggaataccggtgacatatacttgattccaaaaaccatcaatgcc
attgaaggggttataggagccattgaaacgggtatcgactctttattcaagcagaactac
aatttgtccttcattgtgatcaggccgcctggccaccactcccatgcatgtttgccaagc
gggttctgtttgttgaataatgtccagattggtattgaatatgcgtttgaaaactacgat
gttagtcatgtggccattcttgacatcgatttgcaccacggggacgggtctcaggatatt
tgttgggaaagagccggattcaccggcgattatggaaaggacgaagatgaggatcttgaa
cttggattcgaacccagagatgaatatggaaaacggtttgctcgataccccaaggtcggg
tacttttctttgcacgatgtaaagtcataccccacggaattgggctacgccacaaaggaa
aacatcaagaatgcctctacctgcatcatggatcatgatttgaacatttggaacgttcat
cttcaagaatgggaagatgaagacgaattctacaagcactataagactaagtacgtatcg
attctcaacagagtcaaccagttcttgaaccaagccaagaagcagcacgaattggagttc
caacagtacttgataaataagaagaatggtagcttgaactccaacagcaaagataagcct
cctatggccttcaagcccatgatagtcatatcggcagggttcgatgcttctgagtatgaa
aacccccagatgcaacgccatgggatcaatgtgccgacatcgttctactccaagttcacc
aacgatgctgtcaaattatccaaaatccataactcaaagctcatatctttcttggaagga
ggatattcggacggggcgttgaccactggtatcttttctcatttgataggcttgaccaac
agtgtcaatgctcatatggaaggagataaggttgactccaatctctggaactctacgtgg
ggatcagattttgtcatgaaggagttgaccaagggttgcaaaaaaaattggatgccatac
aaacagcccaagaccgatgtgaccatctgggccaacgaagccatcaagctcggccggtcg
atgatgccaaacgcggttctacccaacaattatatctaccaatacaaagaagaaggagcc
ggggacattcctaaccgaatggtcaaagaccttattgatgcggacaccaggattaatgaa
gatggtgggccccggcatacccggtcctacctcaagaaactagcattagcacagcaaaaa
gaatag

DBGET integrated database retrieval system