KEGG   Yamadazyma tenuis: CANTEDRAFT_94383Help
Entry
CANTEDRAFT_94383  CDS       T03099                                 

Definition
(RefSeq) Cu,Zn-superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cten  Yamadazyma tenuis
Pathway
cten04146  Peroxisome
cten04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:cten00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CANTEDRAFT_94383
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    CANTEDRAFT_94383
Enzymes [BR:cten01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CANTEDRAFT_94383
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 18250389
NCBI-ProteinID: XP_006687661
JGI: Cante1_94383
UniProt: G3BAZ8
LinkDB All DBs
Position
Unknown
AA seq 154 aa AA seqDB search
MVKAVAVLRGDAKVTGVVHFEQASESEPTTISWEITGNQPNALRGFHVHAFGDNTNGCTS
AGPHFNPFTKTHGAPEDDERHVGDLGNITTDSEGVAKGTKQDLLLKLIGNNHIIGRSVVV
HDGVDDLGKGAHELSKTTGNAGGRAACGVIGLAN
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggttaaagcagttgctgtattgagaggtgacgccaaagtcaccggagtggttcacttt
gaacaagcctccgagtctgaacctaccaccatttcctgggaaatcaccggtaaccaacca
aacgctttgagaggcttccacgtccatgcctttggtgacaacaccaacggttgtacctct
gccggtcctcacttcaacccattcaccaagacccatggtgcccccgaagacgatgaaaga
catgtgggtgacttgggtaacatcaccaccgactctgagggtgttgccaagggtaccaag
caagatttgttgcttaagttgattggtaacaaccacattatcggaaggagtgttgttgtt
cacgatggtgtcgatgacttgggtaagggtgctcacgaactctccaagaccaccggtaac
gcagggggcagagctgcttgtggagttattggtttagctaactaa

DBGET integrated database retrieval system