KEGG   Candida tenuis: CANTEDRAFT_99232Help
Entry
CANTEDRAFT_99232  CDS       T03099                                 

Definition
(RefSeq) SET domain-containing protein
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
cten  Candida tenuis
Pathway
cten00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cten00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    CANTEDRAFT_99232
Enzymes [BR:cten01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     CANTEDRAFT_99232
Chromosome and associated proteins [BR:cten03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     CANTEDRAFT_99232
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW Med26 SHS2_FTSA
Motif
Other DBs
NCBI-GeneID: 18250839
NCBI-ProteinID: XP_006688342
JGI: Cante1_99232
UniProt: G3BBE8
LinkDB All DBs
Position
Unknown
AA seq 721 aa AA seqDB search
MSESEDDKQQQRRTPPVFLDCESATEEALQTFTQITACSYQNKSIGDSGQNENMTCDCHE
KVEETTNVNHACGDDSGCINRATSVECMAGACNCGDRCQNQRFQRCEYAAISVFQTEKKG
YGVRADTALDEGSFIYEYIGEVIDEATFRRRMVDYDSRQLRHFYFMMLKKDAFIDATEKG
ALARFVNHSCSPNAYVDKWVVGDKLRMGIFAKRHIARGEEITFDYNVDRYGAQSQPCYCG
EPNCIKFMGGKTQTDAALLLPDGISEALGVTPRHERQWLKENKHLRTKQQNNDATINEAF
VKSVEVSEIEEQDVNRVMAAMMKSHDANINRKLVERIYLTDDENVNRQIVRMHGYKTLSA
LLKSQTTDPDTTVKILKVLAKWPKMTRNKIQSSQIEDVVKDIRAHTNNREIRSLSVALLD
EWGKLQMAYRIPKVSHSDAGQISYGRNPRSSSPEKLQDPNPVKHEEPEPQDPSSQTELPP
GWESALDPNTNTMYYFNRDLGETTWERPQVKPKLKLKPVPVPRGPRQDSPPQRSTNNYNE
SQIAEMEAQRLDQEKQMLWQQNLNKQKSLQELILQSQREAEERKAMDLRLKQELTDKARA
RAKAKSKVKGSKSSGTTSSVEKRWSSLFAKYVPNLIKKHTEEIGKDNVKQCAREMVKVLV
MKEMNKDATREPPADFEKSKLKQVKEFTGSYMDKFMIKYRQKHSKRHGEETEGTIKRTKL
T
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaatcggaagacgataaacaacagcaaaggaggacgccaccggtattccttgac
tgtgaaagtgccactgaagaggccttacaaactttcacccagatcaccgcctgttcgtat
caaaacaagctgattggggacctgggtcaaaatgaaaacatgacatgcgactgccatgag
aaggtggaagagaccacaaacgtaaaccacgcatgtggcgacgacagcgggtgcatcaac
cgggccacgtcggtcgagtgtatggcgggcgcctgcaattgtggcgacagatgccagaac
caacggttccaacgttgtgaatatgctgccatcagcgtatttcaaacagaaaaaaagggc
tatggagttcgtgctgacaccgccctcgacgaaggctcgttcatctatgagtatattggt
gaggtgattgacgaggccacttttcgccgccgaatggtcgactatgacagtcggcagtta
agacacttttactttatgatgttgaagaaggatgctttcattgatgccaccgaaaaagga
gcattggctcggtttgtcaaccacctgtgctcccccaatgcctacgtcgacaagtgggtt
gtgggagacaagcttcggatggggatttttgcaaaaagacatattgccagaggtgaagaa
atcacctttgactacaatgtagataggtatggtgcccaactgcaaccgtgttattgtgga
gaacccaactgtatcaagttcatgggtggaaagacccagacggacgcggccctcttgttg
cccgatggtattagcgaagctttgggggtgactcctcgtcacgaacgccagtggttaaag
gaaaataagcacttgcggaccaagcagcagaacaacgacgccaccatcaacgaggcgttc
gtcaagtcggtggaggtgtctgagatcgaggagcaggatgtgaaccgggtcatggctgcc
atgatgaagtctcacgatgccaacatcaaccgcaaattggtggagagaatatacttgacc
gacgacgagaacgtcaaccgacagattgtacgaatgcacggatacaaaacattgctggcg
ttgttgaagtcacagactaccgaccccgataccaccgtgaagattttgaaggtgcttgcc
aaatggcccaagatgacccgaaacaagatccagtcactgcaaattgaggacgtggtgaaa
gatattcgggcccatactaacaacagagagatccgcctgttactggtggcgcttttggat
gagtggggcaagttgcaaatggcttatcgtattcccaaggtgagccacagtgatgccggt
caaattagttatggccggaaccctcgttctctgtcaccagaaaagttgcaggatccaaac
cccgtcaagcacgaagaaccagaaccacaagacccttccagccaaacagaacttcctccc
gggtgggaatctgctttggatcccaacaccaatacgatgtactatttcaaccgagacctt
ggtgagaccacctgggaaagaccccaggtcaagcccaagctcaagctcaagccggtgccg
gtacctcgtggccctcggcaggactcgcctccccagcggtctaccaacaattacaatgag
ctgcagatagctgagatggaagcccaacgtcttgatcaggagaaacaaatgctctggcaa
caaaatctaaataagcaaaagtctttgcaagagttgattctccagtcacagcgtgaagct
gaagaaaggaaagcaatggacttgagattgaaacaagaactcaccgataaagcccgtgcc
agagccaaggccaagtccaaagtcaaaggatccaagagctctggtaccacgtcgagtgtg
gaaaagcggtggagctctttgtttgccaagtatgtgccgaacttgatcaagaagcacaca
gaagaaattggcaaagacaacgtcaagcagtgtgccagagaaatggtcaaggtattggtg
atgaaggaaatgaacaaggacgccacacgagagccaccggccgatttcgagaagagcaag
ctcaagcaagttaaagagttcaccggtagctatatggataagtttatgatcaagtatcgg
cagaagcattccaaaagacatggtgaagaaacagaaggtaccataaaacgaacaaagttg
acgtaa

DBGET integrated database retrieval system