KEGG   Corynebacterium terpenotabidum: A606_00300Help
Entry
A606_00300        CDS       T02714                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cter  Corynebacterium terpenotabidum
Brite
KEGG Orthology (KO) [BR:cter00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cter01001]
    A606_00300
Enzymes [BR:cter01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     A606_00300
Protein kinases [BR:cter01001]
 Serine/threonine kinases: Other
  Bacterial family
   A606_00300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Kinase-like Pkinase_fungal ABC1
Motif
Other DBs
NCBI-ProteinID: AGP29718
UniProt: S4XGD4
LinkDB All DBs
Position
complement(74637..76184)
Genome map
AA seq 515 aa AA seqDB search
MSDETTVFPTGDASSDPLREDARRMQRVLDAYYGPRFHVDRVIGRGGMSTVWLAADSTGR
DVAVKVLKPELTDDQEFRSRFRAEAEAAETVRSPHVVETYDYGEVPDVDGTGVTYCFITM
EYVQGESLADILARERTLPEVMALDLLAQAATGLQAIHARGLVHRDIKPGNLLVTAGGVV
KVTDFGIAKAASAVPLTRTGMVVGTAQYVSPEQAQGHDVGPASDVYSLGVVGYEILAGHR
PFSGESTVSVALKHISTPAPEIPGEVSTPLRQLIGICLRKDAAARYANGAELARATTLVR
EGQLPPEPATATGARAVPVPTPPPSTTVAPAVTGTRLGRVTDPSNMGPAPHTGRRPAKKS
GSGWIWFIILLALAGVGVLVWALTSMSGSGGGNSPTETTTVIQEVPVEPDQDYQDTPAEQ
APQEEFTQPPSVIPSEAPDAGPTSTPDTGDGEQPTTPGDSDSQPTTGNGSDTGTENGAAS
GRSQGPGGANTAMPGAAGDSAETAQNTAGTTTGEA
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgagaccacggtcttccccaccggggacgccagctccgatccgctgcgggag
gacgcccgccggatgcagcgcgtcctcgacgcctactacggtccccggttccacgtcgac
cgggtgatcggccggggcggcatgtccaccgtctggctcgccgccgactccaccggccgc
gatgtggcggtcaaggtcctcaagcccgagctcaccgacgaccaggaattccgctcccgg
ttccgggccgaggcggaggcggccgagaccgtccgttcaccgcacgtcgtcgagacctac
gactacggcgaagtaccggacgtcgacggtaccggcgtgacctactgcttcatcaccatg
gagtatgtccagggcgaatccttggcggacatcctggcccgcgaacgcaccctccccgaa
gtcatggctctggatctgctcgcccaggcggcgaccgggctgcaggcgatccacgcccgc
ggtctggtgcaccgcgacatcaagccgggcaacctgctggtcaccgccggcggggtggtg
aaggtgacggacttcggcatcgccaaggcggcgtccgcggtcccgctgacccggaccggc
atggtcgtcggaaccgcgcagtacgtctccccggagcaggcgcagggtcatgacgtgggc
ccggccagtgacgtctactcgctcggcgtggtcggctacgagatcctggccgggcaccgg
ccgttctccggcgaatcgaccgtgtcggtggcgctgaagcacatcagcacccccgccccg
gagattcccggcgaggtgagcaccccgttgcgtcagctcatcggcatctgcctgcgcaag
gacgccgccgccaggtacgccaacggcgcggaactcgcccgggcgacgacgctggtccgc
gagggtcagctgccgccggaacccgcgacagcgaccggtgcccgagccgttcccgtgcct
actccgccaccgtcgacgacggtcgccccggcggtgaccggtacccgactcggccgtgtc
accgacccctcgaacatgggcccggccccgcacaccggtcgccgcccggcgaagaagtca
ggctccggctggatctggttcatcatcctcctcgcccttgccggcgtcggcgtcctcgtc
tgggcactgacctcgatgtccggctccggcggcgggaactcgccgaccgagaccaccacc
gtcatccaggaggtcccggtggaacccgaccaggattaccaggacacgcccgcggagcag
gccccgcaagaggaattcacccagcccccctcggtcatcccgagtgaggcccccgacgcg
ggaccgacctcaacccccgataccggggacggggagcagcccaccacacccggggattcc
gacagccagcccaccaccggcaacggcagcgacactgggaccgagaacggagcggcgtcc
ggccggtcccagggccccggtggcgcgaacaccgcgatgccgggcgcggcgggtgattcc
gcggagactgctcagaacaccgccggaaccaccacgggagaagcatga

DBGET integrated database retrieval system