KEGG   Corynebacterium terpenotabidum: A606_11225Help
Entry
A606_11225        CDS       T02714                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cter  Corynebacterium terpenotabidum
Pathway
cter00250  Alanine, aspartate and glutamate metabolism
cter00410  beta-Alanine metabolism
cter00430  Taurine and hypotaurine metabolism
cter00650  Butanoate metabolism
cter01100  Metabolic pathways
cter01110  Biosynthesis of secondary metabolites
cter01120  Microbial metabolism in diverse environments
cter02024  Quorum sensing
Module
cter_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cter00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A606_11225
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A606_11225
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A606_11225
   00430 Taurine and hypotaurine metabolism
    A606_11225
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    A606_11225
Enzymes [BR:cter01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     A606_11225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AGP31884
UniProt: S4XH16
LinkDB All DBs
Position
complement(2579302..2580675)
Genome map
AA seq 457 aa AA seqDB search
MTDTPRDLELNPLFARAGEATSFPRNRIPEEGSLPETAYQLIHDEAMLDGNARMNLATFV
GTWMDDHADRLYREAFDKNMIDKDEYPATAEIETRCWRMIADLWNAPDPASAIGTSTIGS
SEACMFGGLALKRRWQHRRRAAGESTEHPNIVLSSAVQVCWEKFCNYFDVEPRYVPVTEE
HRVLDGHDLDRYVDENTIGVVAILGVTYTGMYEPVKDIADALDRIEDATGLDIRIHVDAA
SGGMIAPFLQPDLEWDFRLPRVASINVSGHKYGLVYPGLGWIVWRTAEDLPEDLVFRVSY
LGGDMPTLALNFSRPGAQVLLQYYLFLQLGMDGYRRVQGSTMDVARYLAGEIGAMPEFEL
WNAECDIPVFAWRLAPDPTRRWTLHDLSDRLRMHGWLVPAYPMPDNLADITVQRIVVRNG
MSHDLATYLVRDLRACVGYLNKMDAPLPDGLHSGFHH
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaccccgcgagacctcgaactcaaccccctgttcgcccgcgccggcgaggcg
acgagcttcccccggaaccggatccccgaggaaggctccctgccggaaaccgcctaccag
ctcatccatgatgaggcgatgctcgacggcaacgcccggatgaacctcgctaccttcgtc
ggcacttggatggacgaccacgccgaccgcctctaccgcgaggccttcgacaagaacatg
atcgacaaggacgagtaccccgccaccgcggagatcgagacgcgctgctggcggatgatc
gccgacctgtggaacgctcccgacccggcgtctgccatcggcacctccaccatcggttcc
tccgaggcgtgcatgttcggcggcctcgccctgaaacgacgttggcagcatcgacgccgc
gctgccggggaatccaccgaacacccgaacatcgtcctgtcctcggcggtgcaggtgtgc
tgggagaagttctgcaactacttcgatgtcgaacctcgttatgtgcccgtcaccgaggaa
caccgcgtcctcgacgggcatgacctcgacaggtatgtcgacgagaacacgatcggcgtc
gtcgccatcctcggtgtcacgtacaccggcatgtacgaaccggtgaaggacatcgcggac
gcgctggaccggatcgaggacgccacggggctcgacatccggatccacgtggacgccgcg
tccggcggcatgatcgcccccttcctccaacccgacctggaatgggacttccggctgccg
cgggtagcgtccatcaacgtctccgggcacaagtacgggctggtctaccccggtctcggc
tggattgtttggcgtaccgccgaggacctgcccgaggatctcgtcttccgggtcagctac
ctcggcggcgacatgcccaccctggccctgaacttctcccgccccggtgcacaggtgctg
ctgcagtactacctgttcctgcagctggggatggacggctaccggcgcgtccaggggtcg
accatggatgttgcccgctatctcgccggggagatcggggcgatgccggagttcgaactg
tggaacgcggagtgtgacatccccgtcttcgcctggcggctcgcccccgatccgacgcgc
cggtggacgctccacgatctctccgaccggctccggatgcacggctggctcgtccccgca
taccccatgccggataatctcgcggacatcaccgtgcaacgtatcgtcgtgcgcaacggc
atgagccatgacctggcgacgtacctggtcagggacctgcgtgcgtgtgtcggctacctc
aacaagatggacgccccgctgcccgacgggcttcactcggggttccaccactga

DBGET integrated database retrieval system