KEGG   Corynebacterium terpenotabidum: A606_11420Help
Entry
A606_11420        CDS       T02714                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cter  Corynebacterium terpenotabidum
Pathway
cter00010  Glycolysis / Gluconeogenesis
cter00071  Fatty acid degradation
cter00350  Tyrosine metabolism
cter00625  Chloroalkane and chloroalkene degradation
cter00626  Naphthalene degradation
cter01100  Metabolic pathways
cter01110  Biosynthesis of secondary metabolites
cter01120  Microbial metabolism in diverse environments
cter01130  Biosynthesis of antibiotics
cter01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cter00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A606_11420
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A606_11420
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    A606_11420
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A606_11420
   00626 Naphthalene degradation
    A606_11420
Enzymes [BR:cter01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     A606_11420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N AlaDh_PNT_C 2-Hacid_dh_C ADH_zinc_N_2 adh_short Methyltransf_25 Peripla_BP_4 TrkA_N
Motif
Other DBs
NCBI-ProteinID: AGP31923
UniProt: S4XMN2
LinkDB All DBs
Position
2633112..2634137
Genome map
AA seq 341 aa AA seqDB search
MTEKFTGAVVEKFNTPLVIEEVALPTPGPNQAVVKLIASGICHTDLHAAHGDWPVKPEPP
FVPGHEGVGEVVELGPGEHRVAVGDIVGNAWLWSACGNCDQCLKGWETLCPNAEYGGYTV
DGSFGTYMLVDTRFAPKIPDGADPLEVAPILCAGVTVYKGLKVSETKPGQFMVISGVGGL
GHLAVQYAKAMGMRVIAVDIADDKLELAKKHGAEFTVNALNVDPAEAVQEYTDGGAHGIL
VTAVHPQAFGQAINMARRAGTIVFNGLPPGEFPAPIFDIVLKGLTIRGSLVGDRQDQVEA
LDFYARGLVKPTVTECTLEDVNEVFEKMEKGQIDGRMAIRY
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagaagttcaccggagctgttgtcgaaaagttcaacacgcccctcgtcatcgaa
gaagtcgccctgcccacccccggccccaaccaggcggtcgtcaagctcatcgcctccggc
atctgccacaccgacctccacgccgctcacggcgactggccggtcaagcccgagcccccg
ttcgtgcccggccatgagggtgtcggcgaagttgtcgaactcggccccggtgagcaccgc
gtcgccgtcggcgacatcgtcggcaacgcctggctctggtccgcctgcggcaactgcgac
cagtgcctgaagggctgggagacgctctgcccgaacgccgagtacggcggatacaccgtc
gacggctccttcggcacctacatgctcgtggacacccgcttcgccccgaagatccccgac
ggtgccgaccccctcgaggtcgccccgatcctctgcgcgggcgtcaccgtctacaagggt
ctcaaggtctccgagaccaagcccggccagttcatggtcatctccggcgtcggcggcctc
ggccacctggccgtgcagtacgccaaggcgatgggcatgcgcgtcatcgccgtcgacatc
gccgacgacaagctggagctcgcgaagaagcacggtgccgagttcaccgtcaacgcgctg
aacgtcgacccggccgaggcggtgcaggagtacaccgacggtggtgcgcacggcatcctc
gtcaccgcggtgcacccgcaggcgttcggccaggccatcaacatggcccgacgcgccggc
acgatcgtcttcaacggcctgcccccgggagagttccccgccccgatcttcgacatcgtg
ctcaagggtctgacgatccgtggctcgctcgtcggggaccgccaggaccaggtcgaggcg
ctggacttctacgcccgtggactggtcaagcccaccgtgaccgagtgcacgctcgaggac
gtcaacgaggtcttcgagaagatggagaagggtcagatcgacggtcgcatggcgatccgc
tactga

DBGET integrated database retrieval system