KEGG   Comamonas testosteroni TK102: O987_00155Help
Entry
O987_00155        CDS       T03218                                 

Definition
(GenBank) Gst
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ctes  Comamonas testosteroni TK102
Pathway
ctes00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ctes00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    O987_00155
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ctes02000]
    O987_00155
Enzymes [BR:ctes01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     O987_00155
Transporters [BR:ctes02000]
 Other Transporters
  Pores ion channels [TC:1]
   O987_00155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_2 GST_C_3 GST_N_3 GST_N_2 GST_N GST_C_6
Motif
Other DBs
NCBI-ProteinID: AIJ44232
UniProt: A0A076PLG0
LinkDB All DBs
Position
complement(41800..42408)
Genome map
AA seq 202 aa AA seqDB search
MKLYYSPGACSLSPHIVLHEAELQHETVMVSTKSHKLQDGTDYYGINPLGYVPFLVLDSG
DTLREGPAIVQYLADLAPEKNLAPANGTVARYHLQEWLNFISTEVHKGFGPLFNPATPED
YKPLARASVLKRLAWVNEQLANKSYLMGDQFTVADAYFFTITGWAQFVGLDISELENIQA
YRERILARPAVQAAMKAEGLLK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttactacagccccggcgcctgctccctgtctccgcatatcgtgctgcacgaa
gcagagctgcagcatgaaaccgtgatggtcagcaccaagagccacaagctccaggacgga
acggattactacggcatcaatccgctgggctatgtgccctttctggtgctggacagcggc
gacaccctgcgcgaaggtccggccattgttcagtacctggccgacctggctcccgagaaa
aacctggcgcccgccaacggcaccgtggcccgctaccacctgcaggaatggctgaacttc
atcagcaccgaggtgcacaagggcttcggccccttgttcaatccggcaacgccagaggac
tacaagcccctggcgcgcgccagcgtgctcaagcgcctggcctgggtcaacgagcagctc
gccaacaagagctatctgatgggcgatcagttcaccgtggccgatgcctactttttcacg
atcacgggctgggcccagttcgtgggcctggacatctccgagctcgagaacattcaggcc
taccgcgaacgcattctggcgcgtcccgccgtacaggccgccatgaaggcagaaggcttg
ctgaagtaa

DBGET integrated database retrieval system