KEGG   Comamonas testosteroni TK102: O987_01905Help
Entry
O987_01905        CDS       T03218                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ctes  Comamonas testosteroni TK102
Pathway
ctes00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ctes00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    O987_01905
Enzymes [BR:ctes01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     O987_01905
Transporters [BR:ctes02000]
 Other Transporters
  Pores ion channels [TC:1]
   O987_01905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_2 GST_N Tom37 GST_C GST_C_3 GST_N_4 GST_C_5
Motif
Other DBs
NCBI-ProteinID: AIJ44570
UniProt: A0A076PLP9
LinkDB All DBs
Position
complement(414215..414874)
Genome map
AA seq 219 aa AA seqDB search
MLTLCGFSASNYYNKVKLALMEKQIPFAEELAWLGSTNPEESPLGKVPYLRTQHGAISES
DAIIEYVEALSSKVPLLPADPFAAAKVRELCVYLNLHLELVARNLYPQAFFGGKISDSTR
DKTLEQLKKNIAAFAKLARFDTPFIAGDSFTLADCSAIVHLPLVSSASKILGGSDLLAEL
PVRDYLARMSERPTVQKVNTDRKSNTEELMARMQAKAAR
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgctgactttgtgcggattttcggccagcaactactacaacaaggtcaagctggccttg
atggaaaagcagattcccttcgccgaggagctggcctggctgggcagcaccaatcccgag
gaatcgccgctgggcaaggttccgtatctgcgcacacagcatggcgccatcagcgagtcc
gacgccatcatcgaatatgtggaagcgctgtccagcaaggtgccgctgctgcccgcagac
ccctttgctgccgccaaggtgcgtgagctttgcgtctatctgaacctgcacctggagctg
gtggcgcgcaacctctatccccaggccttcttcggcggcaagatcagcgactccacgcgc
gacaagaccctggagcagctgaaaaagaacattgcggcctttgccaagctggcccgcttc
gacaccccgttcatcgcgggcgacagcttcacgctggccgactgcagcgccatcgtgcat
ctgcccctggtcagcagcgccagcaagatcctgggcggcagcgatctgctggccgagctg
ccggtgcgcgactatctggcgcgcatgagcgagcgtcccacggtgcagaaggtcaacacc
gatcgcaagagcaataccgaagagctgatggcacgcatgcaggccaaggctgcgcgctga

DBGET integrated database retrieval system