KEGG   Comamonas testosteroni TK102: O987_06460Help
Entry
O987_06460        CDS       T03218                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ctes  Comamonas testosteroni TK102
Brite
KEGG Orthology (KO) [BR:ctes00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    O987_06460
Enzymes [BR:ctes01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     O987_06460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_oxidored DAO FAD_binding_3 AlaDh_PNT_C Glutaredoxin NAD_binding_7 K_oxygenase NAD_binding_8 FMO-like Thi4
Motif
Other DBs
NCBI-ProteinID: AIJ45452
UniProt: A0A076PQ33
LinkDB All DBs
Position
1415279..1416835
Genome map
AA seq 518 aa AA seqDB search
MLDDQLKAQLAAYLERVQQPFELVASLDDSETSAQMHDLLKTIQSLRSDKISLRTDGSDA
RKPSFTLQRQGTATQLRFAGLPLGHEFTSLVLALLWTGGHPPKVEQDVIDQIKALDGDFN
FEVYMSLSCHNCPDVVQALSLMAILNPRVKTTVIEGGAFQKEVTEREIMAVPMVFMNGSV
FGSGRMSIEEIVAKLDTGAASRDAAKLSAKEAFDVLIIGGGPAGAAAAVYAARKGIRTGV
AAERFGGQVNDTLAIENYISVLETDGPKFAAALEAHTRAYDVDIMNLQRAEKLIPAAQPG
GLVEVQLANGGSLKAKTVILSTGARWRNVNVPGEAEYKNKGVAYCPHCDGPLFKGKRVSV
IGGGNSGIEAAIDLAGLVAHVTVVEFADQLKADAVLVKKLHSLPNVTVITNAQTTEITGA
NGKVNGLSYKDRATGTEHHVELEGVFVQIGLVPNTEWLKGSVELSKFGEIIVDAKGQTNL
PGVFAAGDCTTVPYKQIVIAAGAGATAALSAFDHLIRH
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacgatcaactcaaagcccaactcgccgcctacctggaacgcgtgcagcagccg
tttgagctggtggcttctctggatgacagcgagaccagtgcacagatgcacgatctgctg
aaaaccatccagtccctgcgcagcgacaagatttccctgcgcaccgacggcagcgatgcc
cgcaagccttcgttcacgctgcagcgccagggcacagccacccagctgcgctttgccggt
ctgcctctgggccatgaattcacctcgctggtgctggccctgctgtggacgggcggccat
cctcccaaggtggagcaggacgtgatcgaccagatcaaggcgctcgatggcgacttcaac
ttcgaggtctacatgagcctgagctgccacaactgccccgatgtggttcaggcactgtcg
ctgatggcgattctcaaccccagggtcaagaccacggtgatcgaaggcggcgccttccag
aaggaagtgaccgagcgcgaaatcatggccgtgcccatggtgttcatgaatggcagcgtg
ttcggctccgggcgcatgagcatcgaggaaatcgtggccaagctggacaccggtgccgcc
tcgcgtgacgccgccaagctgtcggccaaggaagccttcgacgtgctgatcatcggcggc
ggccctgccggcgcggcagccgctgtgtacgccgctcgcaagggcattcgtaccggcgtg
gctgccgagcgcttcggcggtcaggtcaacgacacgctggcgatcgagaactacatctcc
gtgctggaaaccgacggccccaagttcgctgcggccctggaagcccacacccgcgcctat
gacgtggacatcatgaacctgcagcgcgccgagaagctgattcccgcagcgcagcccggc
ggtctggtggaggtgcaactggccaatggcggctcgctcaaggccaagaccgtgatcctg
tccaccggtgcgcgctggcgcaatgtgaacgtgccaggcgaagccgagtacaagaacaag
ggcgtggcctactgcccgcactgcgacggtccgctgttcaagggcaagcgcgtgtcggtg
atcggcggcggcaactccggcattgaagctgcgattgacctggcgggtctggtggctcat
gtgacggtggtggagttcgccgatcagctcaaggccgatgccgtgctggtcaagaagctg
cacagcctgcccaatgtgaccgtcatcaccaatgcgcagaccaccgagatcaccggtgcc
aacggcaaggtcaacggcttgagctacaaggacagggcaacgggcaccgagcaccatgtg
gagctcgagggcgtgtttgtgcagatcggcctggtgccgaacaccgaatggctcaagggc
tcggtggagctgagcaagtttggcgaaatcattgtggatgccaaggggcagaccaatctg
ccaggggtgttcgccgccggtgactgcaccacggtgccttacaagcagatcgtgatcgcc
gccggtgctggcgctaccgcagcactgtcggcctttgatcatctgatccgtcactga

DBGET integrated database retrieval system