KEGG   Comamonas testosteroni TK102: O987_07750Help
Entry
O987_07750        CDS       T03218                                 

Definition
(GenBank) flavin reductase
  KO
K16048  3-hydroxy-9,10-secoandrosta-1,3,5(10)-triene-9,17-dione monooxygenase reductase component [EC:1.5.1.-]
Organism
ctes  Comamonas testosteroni TK102
Pathway
ctes00984  Steroid degradation
ctes01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctes00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    O987_07750
Enzymes [BR:ctes01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.-  
     O987_07750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavin_Reduct MarR_2 TrmB MarR HTH_27 SMC_ScpB
Motif
Other DBs
NCBI-ProteinID: AIJ45698
UniProt: A0A076PJ97
LinkDB All DBs
Position
complement(1686814..1687791)
Genome map
AA seq 325 aa AA seqDB search
MQSTAATFDPKDFRRALGMFGTGVTIVTTRAENGEPVGITANSFNSVSLEPPMVLWSLAK
NARSLPVFQSASTWNVHILSNEQEALSNRFARVGEDKFSGLPLDSEEAHAPLLQDCSARF
RCKTAFQYDGGDHIIFVGEVTGYDATPHPPLLYVTGGYAMASRKAGPVASEPEADTNTAY
SENLIGYLMGRAHFQFLSGLRRPMAAYGMTDADFYVLSLLSIQQPQSPAEIASHMAYTGT
DIGAVALQSLISKGWVEESRDRTESLQLTAQGNESILHVLAAAKAVETDLIASLGEMEAA
TLRNLLKKAIAATDPGLPKLWQARA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagtactgcagcaaccttcgaccccaaagactttcgccgcgccctgggcatgttc
ggcaccggggtcaccatcgtcaccacccgtgccgagaatggcgagcctgtgggaatcacc
gccaacagcttcaattcggtttcgctggagccccccatggtgctgtggagcctggccaag
aacgcgcgcagcctgccggtgttccagagcgccagcacctggaatgtgcatatcctctcc
aacgagcaagaagcactttccaaccgctttgcgcgcgtcggcgaggacaagttctcgggc
ctgccgctggactccgaggaagcccatgccccgctgctgcaggactgcagcgcacgcttc
cggtgcaagacagccttccagtacgacggcggcgaccacatcatcttcgtgggcgaggtc
acaggctacgacgccacccctcacccaccgctgctctatgtgacgggtggctacgccatg
gcttcgcgcaaggcaggccccgtggccagcgaacctgaggccgacaccaacactgcctat
tccgaaaacctgatcggctatctgatgggccgagcgcacttccagtttctgagcggcctg
cgcaggcccatggcggcatacggcatgaccgacgccgatttctacgtgctctcgctgctg
agcatccagcagccccagtcgcctgccgagattgcctctcacatggcctataccggcacc
gatatcggtgccgtggccctgcagtcgctgatcagcaaaggctgggtggaggaaagccgt
gaccgcaccgagtccctgcaactgaccgcccaaggcaacgagtccatcctccatgtgctg
gccgccgccaaggccgtggaaaccgatctgatcgccagcctgggcgagatggaagccgcc
accttgcgcaatctgctcaagaaagccattgccgccacggaccccggcctgcccaagctc
tggcaggccagggcctga

DBGET integrated database retrieval system