KEGG   Comamonas testosteroni TK102: O987_08230Help
Entry
O987_08230        CDS       T03218                                 

Definition
(GenBank) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase
  KO
K10222  2,6-dioxo-6-phenylhexa-3-enoate hydrolase [EC:3.7.1.8]
Organism
ctes  Comamonas testosteroni TK102
Pathway
ctes00621  Dioxin degradation
ctes01100  Metabolic pathways
ctes01120  Microbial metabolism in diverse environments
ctes01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ctes00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    O987_08230
Enzymes [BR:ctes01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.8  2,6-dioxo-6-phenylhexa-3-enoate hydrolase
     O987_08230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Esterase Peptidase_S9 Peptidase_S15 Ndr DUF915
Motif
Other DBs
NCBI-ProteinID: AIJ45792
UniProt: A0A076PQV4
LinkDB All DBs
Position
complement(1793206..1794066)
Genome map
AA seq 286 aa AA seqDB search
MSELNESTTSKFVTINEKGLSNFRIHLNDAGEGEAVIMLHGGGPGAGGWSNYYRNIGPFV
KAGYRVILQDAPGFNKSDTVVMDEQRGLVNARSVKGMMDVLGIEKAHLVGNSMGGAGALN
FALEYPERTGKLILMGPGGLGNSLFTAMPMEGIKLLFKLYAEPSLDTLKQMLNVFLFDQS
LITDELVQGRWANIQRNPEHLKNFLLSSQKLPLSSWDVSPRMGEIKAKTLVTWGRDDRFV
PLDHGLKLVANMPDAQLHVFPRCGHWAQWEHADAFNRLTLDFLANG
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaactcaacgaaagcacgacgagcaaattcgtcaccatcaacgaaaaaggcctc
tccaacttccgcattcacctcaacgatgcaggcgagggcgaagcggtaatcatgctgcac
ggaggcggaccgggagcgggggggtggagcaactactaccgcaacatcggccccttcgtc
aaggccggttaccgcgtgatccttcaggacgcgccgggcttcaacaagtccgacaccgtc
gtgatggacgagcagcgcggcttagtcaacgcgcgctcggtcaaagggatgatggatgta
ctgggcatcgaaaaagcgcacctcgtgggaaattccatgggtggcgcaggcgcgctgaac
tttgctcttgaatacccggagcgcaccggcaagctcatcctcatggggccgggcggattg
ggcaacagcctgttcactgcgatgcccatggaaggaatcaagctgctgtttaagctctac
gccgagccttcgctcgacacgctcaagcagatgctcaacgtcttcctgttcgaccagagc
ctgatcaccgacgaactggtgcaaggacgctgggccaacatccagcgcaaccccgagcac
ctgaagaacttcctcttgagctcgcaaaagttgccactttcgtcctgggacgtgtcgccg
cgcatgggcgagattaaggccaagacgctcgtcacctgggggcgtgacgaccgcttcgtg
ccgctggaccacggcctcaagctggtcgcgaacatgccggatgcgcagttgcacgtcttc
ccgcgctgtggtcactgggcgcaatgggagcatgcggacgccttcaatcggctgacgctg
gacttcctagccaacggctga

DBGET integrated database retrieval system