KEGG   Comamonas testosteroni TK102: O987_13305Help
Entry
O987_13305        CDS       T03218                                 

Definition
(GenBank) 2,4'-dihydroxyacetophenone dioxygenase
  KO
K05913  2,4'-dihydroxyacetophenone dioxygenase [EC:1.13.11.41]
Organism
ctes  Comamonas testosteroni TK102
Pathway
ctes01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ctes00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00363 Bisphenol degradation
    O987_13305
Enzymes [BR:ctes01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.41  2,4'-dihydroxyacetophenone dioxygenase
     O987_13305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 Cupin_7 AraC_binding
Motif
Other DBs
NCBI-ProteinID: AIJ46779
UniProt: A0A076PJ21
LinkDB All DBs
Position
2853894..2854427
Genome map
AA seq 177 aa AA seqDB search
MPEKATNEFWKNLKPISDCFQPDAQPEVYIQNAPTEDERYYVPFSETVLSRPLWISPSQN
KWCDILMAKEAGLVNRHYHPHEVFAYTISGKWGYLEHDWTARAGDFVYETPGEGHTLVAY
EHEQPMRAFFIVKGPLIWLDDDGKPDGYFDVHSYIELCRKHYEKVGIGADYVDTLFR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaaaaagccacgaacgaattttggaagaatctgaagccgatttctgattgcttt
cagcccgatgcgcagccggaagtttatatacagaacgcgcccactgaggacgagcgctat
tatgttccattctcagagactgtattgtcccgccctctctggatttctccatcgcaaaac
aaatggtgcgatattctgatggccaaggaagcgggtctggtcaatcggcattaccacccg
catgaagtatttgcctataccatttccgggaaatggggttatctggagcatgactggacg
gcccgtgccggtgatttcgtctacgagacaccgggggaaggccataccctggtggcctat
gaacatgagcaacccatgcgtgcgttctttatcgtcaaggggccgctgatctggctcgat
gatgacggaaagccggacggatatttcgatgttcacagctacatagagctatgccgaaag
cactatgaaaaagtcggcataggtgcagattatgtggacacgctttttcgatag

DBGET integrated database retrieval system